KEGG   Rattus norvegicus (rat): 81528
Entry
81528             CDS       T01003                                 

Gene name
Ogg1
Definition
(RefSeq) 8-oxoguanine DNA glycosylase
  KO
K03660  N-glycosylase/DNA lyase [EC:3.2.2.- 4.2.99.18]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    81528 (Ogg1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:rno03400]
    81528 (Ogg1)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.-  
     81528 (Ogg1)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     81528 (Ogg1)
DNA repair and recombination proteins [BR:rno03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     81528 (Ogg1)
SSDB
Motif
Pfam: OGG_N HhH-GPD HHH
Other DBs
NCBI-GeneID: 81528
NCBI-ProteinID: NP_110497
RGD: 621168
Ensembl: ENSRNOG00000052140
UniProt: O70249
Position
4q42
AA seq 345 aa
MLFSSSLSSSMRHRTLTSSPALWASIPCPRSELRLDLVLASGQSFRWREQSPAHWSGVLA
DQVWTLTQTEDQLYCTVYRGDKGQVGRPTLEELETLHKYFQLDVSLTQLYSHWASVDSHF
QSVAQKFQGVRLLRQDPTECLFSFICSSNNNIARITGMVERLCQAFGPRLVQLDDVTYHG
FPNLHALAGPEVETHLRKLGLGYRARYVCASAKAILEEQGGPAWLQQLRVASYEEAHKAL
CTLPGVGTKVADCICLMALDKPQAVPVDIHVWQIAHRDYGWQPKTSQTKGPSPLANKELG
NFFRNLWGPYAGWAQAVLFSADLRQQNLSREPPAKRKKGSKKTEG
NT seq 1038 nt   +upstreamnt  +downstreamnt
atgttattcagttccagcctgtctagcagcatgagacatcgcaccctaacctccagcccg
gccctctgggcctctattccgtgtccacgctctgagctgcgtctggacctggttttagct
tctggacagtccttccggtggagggagcaaagccctgctcactggagtggagtgctggca
gatcaagtgtggacactgactcagaccgaggatcagctctattgcactgtgtaccgagga
gacaagggccaggtcggcaggcctaccctagaggagctggaaaccttacacaagtacttt
cagctagatgtcagcctgactcagctctatagccactgggcttcggtggactctcacttc
caaagtgtggctcagaaattccaaggtgtgaggctgctgagacaagaccccactgaatgc
cttttctctttcatctgttcttccaacaacaacattgctcgcatcactggcatggtggaa
cggctgtgccaggcctttggacctcgactcgttcagcttgatgatgtcacttatcatggc
ttcccaaaccttcatgccctggctggtccagaagtagagacccacctcaggaagttgggc
ctggggtaccgtgcccgctatgtatgtgccagtgctaaagccatcctagaagagcaaggt
gggccggcttggctgcagcagcttcgagtggcctcttatgaagaggcccacaaggccctc
tgcaccctgcctggagtgggcaccaaggtggctgactgcatctgcttaatggccctggac
aaaccccaggctgtgcctgtggacatccatgtgtggcagattgcccatcgtgactacggc
tggcagcctaagacatcgcagactaagggcccgagccctctggccaacaaagaactggga
aactttttccggaatctgtggggaccttatgctggctgggcccaagcagtgctgttcagt
gctgaccttcgtcaacaaaacctgtctcgggagccaccagcaaagcgcaaaaagggatct
aagaagacagaaggctag

DBGET integrated database retrieval system