KEGG   Rattus norvegicus (rat): 81574
Entry
81574             CDS       T01003                                 

Gene name
Scn1a
Definition
(RefSeq) sodium voltage-gated channel alpha subunit 1
  KO
K04833  voltage-gated sodium channel type I alpha
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04728  Dopaminergic synapse
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09156 Nervous system
   04728 Dopaminergic synapse
    81574 (Scn1a)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:rno04040]
    81574 (Scn1a)
Ion channels [BR:rno04040]
 Voltage-gated cation channels
  Sodium channel, voltage-gated (Nav)
   81574 (Scn1a)
SSDB
Motif
Pfam: Ion_trans Na_trans_cytopl Na_trans_assoc PKD_channel GPHH Zip IQ ATP-synt_B Pns11_12
Other DBs
NCBI-GeneID: 81574
NCBI-ProteinID: NP_110502
RGD: 69364
Ensembl: ENSRNOG00000053122
UniProt: P04774
Position
3q21
AA seq 2009 aa
MEQTVLVPPGPDSFNFFTRESLAAIERRIAEEKAKNPKPDKKDDDENGPKPNSDLEAGKN
LPFIYGDIPPEMVSEPLEDLDPYYINKKTFIVLNKGKAIFRFSATSALYILTPFNPLRKI
AIKILVHSLFSMLIMCTILTNCVFMTMSNPPDWTKNVEYTFTGIYTFESLIKIIARGFCL
EDFTFLRDPWNWLDFTVITFAYVTEFVDLGNVSALRTFRVLRALKTISVIPGLKTIVGAL
IQSVKKLSDVMILTVFCLSVFALIGLQLFMGNLRNKCVQWPPTNASLEEHSIEKNVTTDY
NGTLVNETVFEFDWKSYIQDSRYHYFLEGVLDALLCGNSSDAGQCPEGYMCVKAGRNPNY
GYTSFDTFSWAFLSLFRLMTQDFWENLYQLTLRAAGKTYMIFFVLVIFLGSFYLINLILA
VVAMAYEEQNQATLEEAEQKEAEFQQMLEQLKKQQEAAQQAAAATASEHSREPSAAGRLS
DSSSEASKLSSKSAKERRNRRKKRKQKEQSGGEEKDDDEFHKSESEDSIRRKGFRFSIEG
NRLTYEKRYSSPHQSLLSIRGSLFSPRRNSRTSLFSFRGRAKDVGSENDFADDEHSTFED
NESRRDSLFVPRRHGERRNSNLSQTSRSSRMLAGLPANGKMHSTVDCNGVVSLVGGPSVP
TSPVGQLLPEVIIDKPATDDNGTTTETEMRKRRSSSFHVSMDFLEDPSQRQRAMSIASIL
TNTVEELEESRQKCPPCWYKFSNIFLIWDCSPYWLKVKHIVNLVVMDPFVDLAITICIVL
NTLFMAMEHYPMTEHFNHVLTVGNLVFTGIFTAEMFLKIIAMDPYYYFQEGWNIFDGFIV
TLSLVELGLANVEGLSVLRSFRLLRVFKLAKSWPTLNMLIKIIGNSVGALGNLTLVLAII
VFIFAVVGMQLFGKSYKDCVCKIATDCKLPRWHMNDFFHSFLIVFRVLCGEWIETMWDCM
EVAGQAMCLTVFMMVMVIRNLVVLNLFLALLLSSFSADNLAATDDDNEMNNLQIAVDRMH
KGVAYVKRKIYEFIQQSFVRKQKILDEIKPLDDLNNRKDNCTSNHTTEIGKDLDCLKDVN
GTTSGIGTGSSVEKYIIDESDYMSFINNPSLTVTVPIAVGESDFENLNTEDFSSESDLEE
SKEKLNESSSSSEGSTVDIGAPAEEQPVMEPEETLEPEACFTEGCVQRFKCCQISVEEGR
GKQWWNLRRTCFRIVEHNWFETFIVFMILLSSGALAFEDIYIDQRKTIKTMLEYADKVFT
YIFILEMLLKWVAYGYQTYFTNAWCWLDFLIVDVSLVSLTANALGYSELGAIKSLRTLRA
LRPLRALSRFEGMRVVVNALLGAIPSIMNVLLVCLIFWLIFSIMGVNLFAGKFYHCVNTT
TGDTFEITEVNNHSDCLKLIERNETARWKNVKVNFDNVGFGYLSLLQVATFKGWMDIMYA
AVDSRNVELQPKYEESLYMYLYFVIFIIFGSFFTLNLFIGVIIDNFNQQKKKFGGQDIFM
TEEQKKYYNAMKKLGSKKPQKPIPRPGNKFQGMVFDFVTRQVFDISIMILICLNMVTMMV
ETDDQSDYVTSILSRINLVFIVLFTGECVLKLISLRHYYFTIGWNIFDFVVVILSIVGMF
LAELIEKYFVSPTLFRVIRLARIGRILRLIKGAKGIRTLLFALMMSLPALFNIGLLLFLV
MFIYAIFGMSNFAYVKREVGIDDMFNFETFGNSMICLFQITTSAGWDGLLAPILNSKPPD
CDPNKVNPGSSVKGDCGNPSVGIFFFVSYIIISFLVVVNMYIAVILENFSVATEESAEPL
SEDDFEMFYEVWEKFDPDATQFMEFEKLSQFAAALEPPLNLPQPNKLQLIAMDLPMVSGD
RIHCLDILFAFTKRVLGESGEMDALRIQMEERFMASNPSKVSYQPITTTLKRKQEEVSAV
IIQRAYRRHLLKRTVKQASFTYNKNKLKGGANLLVKEDMIIDRINENSITEKTDLTMSTA
ACPPSYDRVTKPIVEKHEQEGKDEKAKGK
NT seq 6030 nt   +upstreamnt  +downstreamnt
atggagcaaacagtgcttgtaccaccaggacctgacagcttcaacttcttcaccagagaa
tctcttgcagctattgaaaggcgcattgcagaagaaaaagctaagaatcccaagccagac
aaaaaagatgatgatgaaaatggcccaaagccgaacagtgacttggaagctgggaagaac
cttccatttatctatggagacattcctccagagatggtgtcggagcctctggaggacctg
gacccctactatatcaataagaaaacttttatagtattgaataaagggaaggccatcttc
cggttcagtgccacttctgccctgtacattttaactcccttcaatcctcttaggaaaata
gctattaagattttggtacactcattattcagcatgttaattatgtgcactattttgacg
aactgtgtatttatgacaatgagtaaccctcctgactggacaaagaatgtagagtacacc
ttcacaggaatatatacctttgaatcactaataaaaattattgcaaggggcttctgttta
gaagattttactttccttcgtgacccatggaactggctggacttcactgtcattacattc
gcatatgtgacggagtttgtggacctgggcaatgtctcagcgttgagaacattcagagtt
cttcgagcattgaaaacaatatcagtcattccaggcctgaagaccatcgtgggggccctg
atccagtctgtgaagaagctctctgacgtcatgatcctcaccgtgttctgtctcagtgtg
tttgctctaatcgggttgcagcttttcatgggcaacctgaggaataagtgtgtacagtgg
ccccccaccaacgcttcccttgaggaacatagcatagagaagaatgtaactacggattac
aacggcacacttgtaaatgaaaccgtgtttgaatttgactggaaatcatacattcaagac
tcaagatatcattatttcctggagggtgttttagatgcactactgtgtggaaatagctct
gatgcaggccaatgtccagaaggttacatgtgtgtaaaagctggcagaaaccctaactat
ggttacacaagctttgacaccttcagctgggcatttctgtccctgtttcgactgatgact
caggacttctgggaaaatctttaccaactgacattgcgtgctgccgggaaaacatacatg
atattttttgtgctggtcattttcttgggctcattctacctgataaacttgatcctggct
gtggtggccatggcctatgaggaacagaaccaggccacattggaggaggctgaacagaag
gaggcagagtttcagcagatgctggagcaactgaagaagcagcaggaagccgcacagcag
gcggcggcagcaacagcatcagaacattccagggagcccagtgcagcgggcaggctctca
gatagctcttcagaagcctccaagttgagttcaaagagcgctaaagaaaggcggaatcgg
aggaaaaaaagaaaacagaaagagcagtctggaggggaagagaaagatgatgatgaattc
cacaaatccgagtccgaagatagcatcaggaggaagggcttccgcttctccatagaaggg
aacagactgacctatgaaaagaggtactcttccccacatcagtctctgttgagcattcgc
ggctcactgttttccccgagacgcaatagcagaacaagtcttttcagcttcagagggcga
gcgaaggacgtggggtctgagaatgattttgcggacgatgagcacagcaccttcgaggac
aatgagagcaggagagactctctgtttgttccccgaagacatggagagcgacgcaacagt
aacctcagccaaaccagcagatcctcccgaatgctggcggggcttccagcaaacgggaag
atgcacagcacagtggattgcaatggtgtggtttccttggtgggcggaccctcggttccg
acatcgccagttggacagcttctgccagaggtgataatagataagccagctactgatgac
aatggaacaactactgaaactgagatgagaaagaggaggtcaagttctttccatgtttcc
atggactttcttgaggatccttcccagaggcaaagggcaatgagcattgccagcatctta
acaaatacagtagaagaactagaagaatccagacagaaatgtccaccctgttggtataaa
ttttccaacatatttttaatttgggactgttctccatattggctaaaagttaaacatatt
gtcaacctggttgtgatggacccatttgttgacctggcaattactatctgtattgtgtta
aatacccttttcatggccatggagcactaccccatgactgaacatttcaatcatgtactt
acagtaggaaacttggttttcactgggatcttcacagcagaaatgttcctgaaaatcatt
gccatggacccttactattatttccaagagggctggaatatctttgatggtttcattgtg
acactcagcctggtagaacttggccttgccaatgtggaagggttatcagttctccgttca
ttccgactgctccgagtcttcaagttggcaaagtcctggcccacactgaacatgctcatt
aagatcatcggcaactcggtgggcgcactgggcaacctgaccctggtgctggccatcatc
gtcttcatttttgccgtggtcggcatgcagctgttcggcaaaagttacaaagattgtgtc
tgcaaaattgccactgactgcaaactcccgcgctggcacatgaacgacttcttccactcc
ttcctgatcgtgttccgagtgctgtgtggggagtggatagagaccatgtgggactgcatg
gaggtcgcgggtcaagccatgtgccttactgtcttcatgatggtcatggtgattaggaac
cttgtggtcctgaacctctttctggccttgcttctgagctcatttagtgcagacaacctt
gcagccactgacgatgacaacgaaatgaacaaccttcaaattgctgtggacaggatgcac
aaaggagtagcttatgtaaaaagaaaaatatatgagtttattcaacagtcctttgttagg
aaacagaagatcctagatgaaattaagccacttgatgatctaaacaacagaaaagacaat
tgtacatctaaccacacgacagagattgggaaagatctggactgtctgaaagatgtgaat
ggaaccacgagtggcatagggaccggcagcagtgtggaaaagtacatcattgatgagagt
gactacatgtcattcataaacaaccccagcctcaccgtgactgtgcccattgctgtggga
gagtctgactttgaaaacttaaacacagaggactttagcagtgaatcagatctagaagaa
agcaaagagaaactcaacgaaagcagtagttcctcagaaggaagcacagtagacatcggg
gcgcctgcggaggaacagcctgtcatggaaccagaagaaacccttgagcccgaagcttgc
ttcactgaaggctgtgtgcagagattcaagtgctgtcaaatcagtgtggaagaaggaaga
ggaaaacagtggtggaaccttcggagaacgtgcttccgaatagttgagcacaactggttt
gagaccttcattgtgttcatgattctcctcagtagtggtgccctggcctttgaggatata
tacattgatcagcgaaagacaatcaagaccatgctggagtatgcagacaaggttttcact
tacatttttatcctggagatgctcctcaaatgggtagcctacggctatcaaacgtatttc
accaatgcctggtgttggctggacttcttaattgttgatgtttcattggtcagtttaaca
gcaaatgccttgggttactctgaacttggggccatcaagtccctaaggacactaagagct
ctgagacccctaagagccttatcacgatttgaagggatgagggtggttgtgaatgccctg
ttaggagcaattccatccatcatgaatgtgcttctggtttgccttatattctggctaatt
ttcagcatcatgggcgtaaatttgtttgctggcaaattctaccactgtgttaacaccaca
actggtgacacatttgagatcaccgaagtcaataatcattctgattgcctaaaactaata
gaaagaaatgagactgcccggtggaaaaatgtgaaagtaaactttgataatgtaggattt
gggtatctttctttgcttcaagttgcgacgtttaagggttggatggatatcatgtatgca
gcagttgattccagaaatgtggaactgcagcctaagtatgaggaaagcctgtacatgtac
ctgtacttcgtcatcttcatcatcttcggctcgttcttcactctaaatctattcatcggt
gtcatcatagacaacttcaaccagcagaagaagaagtttggaggtcaagacatctttatg
acagaagaacagaagaaatactataatgcaatgaagaaattaggatcaaaaaagccacaa
aagcctatccctcgacctggaaacaaatttcaaggaatggtctttgactttgtaaccaga
caagtgtttgacatcagcatcatgatcctcatctgtctgaacatggtgaccatgatggtg
gaaacggatgaccagagcgattatgtgacaagcattttgtcacgtatcaacctggtgttc
attgtgctgttcaccggcgagtgcgtgctgaagctcatctccctccgccattattatttc
accattggctggaatattttcgattttgtggtggtcatcctctccattgtaggaatgttt
cttgcggagctgatagagaagtatttcgtgtcccctaccctgttccgagtcatccgcctg
gccaggattggacgaatcctacgcctgatcaaaggcgccaaggggatccgcactctgctc
tttgctctgatgatgtcccttcctgcgctgttcaacatcggcctcctgcttttcctggtc
atgttcatctacgccatctttgggatgtccaactttgcctatgttaagagggaagttgga
attgatgacatgttcaactttgagacttttggcaacagcatgatctgcctgttccaaatc
accacctctgcgggctgggacggactgctggcccccatcctcaacagcaaaccccctgac
tgtgaccctaataaagttaaccccggaagctcggtgaagggggactgtgggaacccatcc
gtggggattttcttttttgtcagctacatcatcatatccttcctggtggtggtgaacatg
tacatcgctgtcatcctggagaacttcagcgttgccaccgaagaaagtgcagagcccctg
agtgaggacgactttgagatgttctacgaggtctgggagaagttcgaccctgacgccact
cagttcatggaatttgaaaaattatctcagtttgcagctgctctcgaaccccctctcaac
ttaccacaaccgaacaaacttcagctcattgccatggacctgcccatggtgagtggagac
cgcatccactgcctggacatcttgtttgcttttacaaagcgggtcttgggcgagagtgga
gagatggacgctcttcgaatccagatggaagaaaggttcatggcttccaacccctccaag
gtctcctatcagccaatcactacaacgttaaaacgaaagcaagaggaggtgtcagccgtt
atcattcagcgcgcttacaggcgccaccttttgaagcgaacagtaaaacaagcttcattc
acatacaataagaacaaactcaagggcggggctaatcttcttgtaaaagaagacatgatc
attgacaggataaatgaaaactctattacagagaaaactgacctgacgatgtccactgca
gcttgtccgccctcctacgaccgggtgacaaagccaatcgtggagaaacacgagcaggaa
ggaaaagatgagaaagccaaagggaaatga

DBGET integrated database retrieval system