KEGG   Rattus norvegicus (rat): 81639
Entry
81639             CDS       T01003                                 

Gene name
Alox15
Definition
(RefSeq) polyunsaturated fatty acid lipoxygenase ALOX15
  KO
K00460  arachidonate 15-lipoxygenase [EC:1.13.11.33]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00590  Arachidonic acid metabolism
rno00591  Linoleic acid metabolism
rno01100  Metabolic pathways
rno04216  Ferroptosis
rno04217  Necroptosis
rno04726  Serotonergic synapse
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    81639 (Alox15)
   00591 Linoleic acid metabolism
    81639 (Alox15)
 09140 Cellular Processes
  09143 Cell growth and death
   04216 Ferroptosis
    81639 (Alox15)
   04217 Necroptosis
    81639 (Alox15)
 09150 Organismal Systems
  09156 Nervous system
   04726 Serotonergic synapse
    81639 (Alox15)
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.33  arachidonate 15-lipoxygenase
     81639 (Alox15)
SSDB
Motif
Pfam: Lipoxygenase PLAT
Other DBs
NCBI-GeneID: 81639
NCBI-ProteinID: NP_112272
RGD: 70493
Ensembl: ENSRNOG00000019183
UniProt: Q02759
Position
10
AA seq 663 aa
MGVYRIRVSTGDSKYAGSNNEVYLWLVGQHGEASLGKLLRPCRDSEAEFKVDVSGYLGPL
LFVRVQKWHYLTDDAWFCNWISVKGPGDQGSEYMFPCYRWVQGRSILSLPEGTGCTVVED
SQGLFRKHREEELEERRSLYRWGNWKDGSILNVAAASISDLPVDQRFREDKRIEFEASQV
IGVMDTVVNFPINTVTCWKSLDDFNCVFKSGHTKMAERVRNSWKEDAFFGYQFLNGANPM
VLKRSTCLPARLVFPPGMEKLQAQLNKELQKGTLFEADFFLLDGIKANVILCSQQYLAAP
LVMLKLMPDGQLLPIAIQLELPKTGSTPPPIFTPSDPPMDWLLAKCWVRSSDLQLHELQA
HLLRGHLMAEVFAVATMRCLPSVHPVFKLLVPHLLYTMEINVRARSDLISERGFFDKAMS
TGGGGHLDLLKQAGAFLTYCSLCPPDDLAERGLLDIETCFYAKDALRLWQIMNRYVVGMF
NLHYKTDKAVQDDYELQSWCREITDIGLQGAQDRGFPTSLQSRAQACYFITMCIFTCTAQ
HSSVHLGQLDWFYWVPNAPCTMRLPPPTTKEATMEKLMATLPNPNQSTLQINVVWLLGRR
QAVMVPLGQHSEEHFPNPEAKAVLKKFREELAALDKEIEIRNKSLDIPYEYLRPSMVENS
VAI
NT seq 1992 nt   +upstreamnt  +downstreamnt
atgggtgtctaccgcatccgcgtctccaccggagactccaagtacgcgggctccaacaac
gaggtctacctgtggttggttggacagcatggagaggcatctctcgggaagctgctacga
ccctgtcgggactcggaagcagaattcaaagtggatgtgtcaggataccttgggccactg
ctgttcgtaagagtgcagaaatggcattatctcacggatgacgcctggttctgcaactgg
atttctgtgaagggccccggagaccaaggatcagagtacatgttcccctgttaccgatgg
gttcagggcagaagcatcctgagcctccctgagggcactggctgcaccgtggttgaagat
tctcaaggactgttcaggaaacatagggaagaggagcttgaagagaggaggagtctgtac
aggtggggcaactggaaggatggctcaatcctgaatgtggcggcggccagtatatctgac
ctccctgtagaccaacgatttcgagaggacaaaagaattgaatttgaagcttcacaggtt
ataggggtaatggatactgttgtcaactttcctataaacactgtgacctgctggaaaagc
ctagatgacttcaactgcgttttcaagagtggccataccaaaatggctgagcgggttcga
aactcctggaaggaagatgcgttctttgggtaccaattcctcaatggtgctaaccccatg
gtgctgaagcgctctacttgtcttcctgcccgcctggtattccctccaggaatggagaag
ctacaggcccagctgaacaaggagctccagaaaggcactctgtttgaagcggatttcttc
cttctggatgggatcaaggccaatgtcatcctttgtagccagcagtacctggctgcccct
ctcgtcatgctgaagctgatgcctgatggacaactcttgcccatagccatccagcttgaa
cttcccaaaactgggtctactccaccacctattttcacgccctcggatcccccaatggac
tggctcctagccaaatgctgggtccggagctccgacttacagctccatgagctgcaggct
catcttctgaggggacacttgatggctgaggtctttgctgtggccaccatgaggtgcctg
ccttccgtgcaccctgtttttaagcttctagttcctcatctgctttacaccatggaaatt
aatgtccgggccaggagtgacctgatctcagagagaggcttttttgacaaggcaatgagc
acaggtgggggaggccacctggatcttctcaagcaagctggagcctttctgacctattgc
tcattgtgtccccccgatgacttggctgagcgaggactcttggatatcgagacttgcttc
tatgctaaagacgccctgcgactctggcagatcatgaatcggtacgtggtgggaatgttc
aatctccactacaagaccgacaaagctgtgcaagacgactatgaactgcagagctggtgt
cgagagatcactgacattggtcttcaaggggcccaggacagaggcttccctacctctctt
cagtcccgggctcaggcttgctacttcatcaccatgtgcatcttcacgtgcaccgcacag
cactcttccgtccatcttggccagctggattggttctactgggttcctaatgcaccctgc
accatgcggctgccaccacccaccaccaaggaagcaacaatggagaagctgatggctaca
ctgcccaaccctaatcagtctactctccagataaatgtcgtttggctcctgggcagacgc
caggctgttatggtgcccctgggccagcattcagaggaacactttccaaaccctgaggcc
aaggctgtgctgaagaagttcagagaggaactggctgccttggataaggaaattgagatt
cgtaataagagcttggacataccttatgagtacctgcggcccagcatggtggaaaacagc
gtggccatatga

DBGET integrated database retrieval system