KEGG   Rattus norvegicus (rat): 81709
Entry
81709             CDS       T01003                                 

Gene name
Msh2
Definition
(RefSeq) DNA mismatch repair protein Msh2
  KO
K08735  DNA mismatch repair protein MSH2
Organism
rno  Rattus norvegicus (rat)
Pathway
rno01524  Platinum drug resistance
rno03430  Mismatch repair
rno05200  Pathways in cancer
rno05210  Colorectal cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03430 Mismatch repair
    81709 (Msh2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    81709 (Msh2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    81709 (Msh2)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    81709 (Msh2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:rno03400]
    81709 (Msh2)
DNA repair and recombination proteins [BR:rno03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    Mismatch and loop recognition factors
     81709 (Msh2)
SSDB
Motif
Pfam: MutS_V MutS_III MutS_II MutS_I MutS_IV AAA_27
Other DBs
NCBI-GeneID: 81709
NCBI-ProteinID: NP_112320
RGD: 620786
Ensembl: ENSRNOG00000015796
UniProt: P54275
Position
6
AA seq 933 aa
MAVQPKETLQLEGAAEVGFVRFFEGMPEKPSTTVGLFDRGDFYTAHGEDALLAAREVFKT
QGVIKYMGPAGAKTLQTVVLSKMNFESFVKDLLLVRHYRVEVYKNKAGNKASKENDWYLA
YKASPGNLSQFEDILFGNNDMATSIGIMGIKLSTVDGQRQVGVGDVDSTQRKLGLCEFPD
NDQFSNLEALLIQIGPKECILPGGETAGDMGKLRQVIQRGGILITERKRIDFSTKDIYQD
LNRLLKGRKGEQMNSAVLPEMENQVAVSSLSAVIKFLELLSDDSNFGQFELATFDFSQYM
KLDMAAVRALNLFQGSVEDTTGSQSLAAFLNKCKTAQGQRLVSQWIKQPLMDKNRIEERL
NLVEAFVEDSELRRALQEDLLRRFPDLNRLAKKFQRQAANLQDCYRLYQGVKQLPNVIQA
LEKYQGRHQALLLAVFVTPLTDLRSDFSKFQEKIETTLDMDQVENHEFLVKPSFDPNLSE
LREVMDGLEKKMQSTLISAARGLGLDPGKQIKLDSSAQFGYYFRVTCKEEKVLRNNKNFS
TVDIQKNGVKFTNSELSSLNEEYTKNKGEYEEAQDAIVKEIVNISSGYVEPMQTVNDVLA
HLDAVVSFAHVSNAAPVPYVRPVILEKGKGRIIVKASRHACVEVQHDVAFIPNDVHFEKD
KQMFHIITGPNMGGKSTYIRQTGVIVLMAQIGCFVPCESAEVSIVDCILARVGAGDSQLK
GVSTFMAEMLETASILRSATKDSLIIIDELGRGTSTYDGFGLAWAISEYIATNIGAFCMF
ATHFHELTALASQIPTVNNLHVTALTTEETLTMLYQVKTGVCDQSFGIHVAELANFPRHV
IECAKQKALELEEFQSIGTSQGHDETQPAAKRRCLEREQGEKIILEFLSKVKQVPFTDLS
EESVSVKLKQLKAEVLAKNNSFVNEIISRVKAP
NT seq 2802 nt   +upstreamnt  +downstreamnt
atggcagttcagcccaaggagacgctgcagttggagggcgcggccgaggtgggcttcgta
cgcttctttgagggcatgccggagaagccgagcaccacggtcggcctcttcgaccgcggc
gacttttacaccgcgcacggcgaggacgcgctgctggcggcccgcgaggtgttcaagacc
caaggcgtgatcaagtacatggggccggcaggggcaaagaccctgcagactgttgtgctg
agtaagatgaattttgagtctttcgtgaaagatcttcttctggttcgtcactatagagtt
gaagtttataagaataaagctggaaataaggcatctaaggagaacgactggtatttggca
tataaggcttctcctggcaatctttctcagtttgaagacatcctgtttggtaacaatgac
atggccacttccattggcattatgggtattaaactgtctacggttgatggtcagagacag
gttggagttggggatgtggattccacccagagaaagctaggattgtgtgagttccctgac
aacgatcagttctccaatctcgaggctcttctgattcagattggaccaaaggaatgcatt
ttaccaggcggagagactgctggagacatggggaaactgaggcaggttatacagagagga
gggattctgatcacagaaagaaagagaatcgacttttccacaaaagacatctaccaggat
ctcaaccggttactgaaaggcagaaaaggagagcagatgaacagcgctgtcttaccagag
atggagaatcaggttgcagtttcatcgttgtctgcagtgatcaagttcctagaactctta
tcagatgattcgaattttgggcagtttgaactggcgacttttgacttcagccagtacatg
aagttagacatggcagcagttagagccctcaaccttttccagggttctgttgaagacacc
acaggctctcagtctctggctgcattcttgaataaatgcaaaactgctcaaggacaaagg
ctggttagccagtggatcaaacagccgctcatggataaaaacaggattgaagagagatta
aatttagtggaagcttttgttgaagattcagaattgaggagagctctacaggaggattta
cttcgccgatttccagatcttaaccggcttgccaagaaatttcagagacaagcagcgaat
ttacaagattgttaccgactgtatcagggtgtgaaacagcttcccaacgtcatccaggct
ctggagaaataccaaggaagacaccaggcattgttgttggcagtttttgtgactcctctt
actgatcttcgttctgatttttcaaaatttcaagaaaagatagaaacgactttagatatg
gatcaggtggagaaccacgaattccttgtaaaaccttcatttgatcctaacctgagtgag
ctaagagaagtcatggatggtctggagaagaagatgcagtccaccttaataagtgcagcg
cggggtcttggattggaccctggcaaacagattaaattggactccagtgcacagtttggg
tattactttcgtgtaacctgcaaggaagagaaagtcctccgcaacaacaagaacttcagc
accgtggatatccagaagaatggcgttaaattcaccaacagtgaattgtcttctttaaat
gaagaatacactaagaacaaaggagagtatgaggaggcccaggatgccattgttaaagaa
atcgtcaatatttcctcaggctacgtggagccaatgcagaccgtcaatgacgtgctagct
cacttagatgccgtcgttagttttgctcatgtgtcaaacgcagctcctgtcccctacgtg
cgaccggtcatcttggagaaaggaaaaggaagaattatagtgaaagcctccaggcatgct
tgtgttgaagttcaacatgacgttgcttttattccaaacgatgtgcactttgaaaaagat
aaacagatgttccacatcattaccgggccgaacatgggaggaaagtcaacatacatccgt
cagacgggggtgattgtgctcatggcccaaattgggtgttttgtgccgtgtgagtcagca
gaggtgtccattgtggattgcatcttggctcgagtcggggctggtgacagtcagctgaaa
ggcgtctccacattcatggctgaaatgctggaaactgcttctatcctcaggtcggcaacc
aaagattccttaataatcattgatgagctgggaagaggaacctctacatacgacggcttt
gggttagcatgggccatatcggagtacatcgcaacgaacattggtgccttttgcatgttt
gccacccattttcatgaacttaccgctttggccagtcagataccaaccgttaacaatctc
cacgtcacagcgctgactaccgaagagaccctgactatgctttaccaagtgaaaacaggt
gtctgtgatcagagtttcgggattcatgtggctgaactcgctaatttccctaggcatgtg
atagagtgcgccaagcagaaggctctggagcttgaggagtttcagagcattgggacctca
cagggacacgatgaaacccagccagctgcaaagaggcgctgcctggaaagagagcaaggt
gagaagattattctggagttcctgtccaaggtcaagcaagtgcccttcactgacttgtcg
gaggagagcgtctcagtgaagctgaagcaactgaaagctgaggtgctggcgaagaacaac
agctttgtaaatgaaatcatctcacgggtaaaggctccgtga

DBGET integrated database retrieval system