KEGG   Rattus norvegicus (rat): 81718
Entry
81718             CDS       T01003                                 

Gene name
Cdo1
Definition
(RefSeq) cysteine dioxygenase type 1
  KO
K00456  cysteine dioxygenase [EC:1.13.11.20]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00270  Cysteine and methionine metabolism
rno00430  Taurine and hypotaurine metabolism
rno01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    81718 (Cdo1)
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    81718 (Cdo1)
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.20  cysteine dioxygenase
     81718 (Cdo1)
SSDB
Motif
Pfam: CDO_I PCO_ADO Methyltransf_2
Other DBs
NCBI-GeneID: 81718
NCBI-ProteinID: NP_434696
RGD: 69262
Ensembl: ENSRNOG00000000158
UniProt: P21816
Structure
PDB: 

Position
18q11
AA seq 200 aa
MERTELLKPRTLADLIRILHELFAGDEVNVEEVQAVLEAYESNPAEWALYAKFDQYRYTR
NLVDQGNGKFNLMILCWGEGHGSSIHDHTDSHCFLKLLQGNLKETLFDWPDKKSNEMIKK
SERTLRENQCAYINDSIGLHRVENVSHTEPAVSLHLYSPPFDTCHAFDQRTGHKNKVTMT
FHSKFGIRTPFTTSGSLENN
NT seq 603 nt   +upstreamnt  +downstreamnt
atggaacggaccgagctgctgaagccccggaccctggccgacctcatccgaatcttgcat
gagctcttcgccggggacgaagtcaatgtggaggaggtgcaggctgtgctggaagcctac
gagagcaatcctgccgagtgggctttgtatgccaaattcgatcaatacaggtatacccga
aaccttgtggatcaaggaaatgggaagtttaatctgatgattctgtgctggggtgaaggg
catggcagcagtattcacgatcacacggactcccactgctttttgaagctgctgcaagga
aatctaaaggagacattgtttgactggcctgacaagaaatccaacgagatgatcaagaag
tctgaaagaactttgagggaaaatcagtgtgcctacattaatgattctattggcttacat
cgagtagagaacgtcagccacacagagcctgctgtgagccttcacttgtacagtccacct
ttcgatacatgccatgcctttgaccaacgaacagggcataaaaacaaagtcaccatgaca
ttccacagcaaatttggaatcagaactccatttacaacttcaggttcactggagaacaac
taa

DBGET integrated database retrieval system