KEGG   Rattus norvegicus (rat): 81725
Entry
81725             CDS       T01003                                 

Symbol
Musk
Name
(RefSeq) muscle, skeletal receptor tyrosine protein kinase precursor
  KO
K05129  muscle, skeletal, receptor tyrosine kinase [EC:2.7.10.1]
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    81725 (Musk)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     81725 (Musk)
Protein kinases [BR:rno01001]
 Receptor tyrosine kinases (RTK)
  MUSK family
   81725 (Musk)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr I-set Ig_3 Pkinase Ig_2 ig Fz C2-set_2 V-set Ig_6 CD34_antigen Ig_4 Haspin_kinase Izumo-Ig
Other DBs
NCBI-GeneID: 81725
NCBI-ProteinID: NP_112323
RGD: 3211
Ensembl: ENSRNOG00000033567
UniProt: Q62838
Structure
PDB: 
1LUF 3HKL 2IEP

Position
5
AA seq 868 aa
MRELVNIPLLQMLTLVAFSGTEKLPKAPVITTPLETVDALVEEVATFMCAVESYPQPEIS
WTRNKILIKLFDTRYSIRENGQLLTILSVEDSDDGIYCCTANNGVGGAVESCGALQVKMK
PKITRPPINVKIIEGLKAVLPCTTMGNPKPSVSWIKGDSALRENSRIAVLESGSLRIHNV
QKEDAGQYRCVAKNSLGTAYSKLVKLEVEVFARILRAPESHNVTFGSFVTLRCTAIGMPV
PTISWIENGNAVSSGSIQENVKDRVIDSRLQLFITKPGLYTCIATNKHGEKFSTAKAAAT
VSIAEWSKSQKESKGYCAQYRGEVCDAVLVKDSLVFFNTSYPDPEEAQELLIHTAWNELK
AVSPLCRPAAEALLCNHLFQECSSGVLPTPMPICREYCLAVKELFCAKEWLAMEGKTHRG
LYRSGMHFLPVPECSKLPSMHQDPTACTRLPYLDYKKENITTFPSITSSKPSVDIPNLPA
STSSFAVSPAYSMTVIISIMSCFAVFALLTITTLYCCRRRREWKNKKRESAAVTLTTLPS
ELLLDRLHPNPMYQRMPLLLNPKLLSLEYPRNNIEYVRDIGEGAFGRVFQARAPGLLPYE
PFTMVAVKMLKEEASADMQADFQREAALMAEFDNPNIVKLLGVCAVGKPMCLLFEYMAYG
DLNEFLRSMSPHTVCSLSHSDLSTRARVSSPGPPPLSCAEQLCIARQVAAGMAYLSERKF
VHRDLATRNCLVGENMVVKIADFGLSRNIYSADYYKADGNDAIPIRWMPPESIFYNRYTT
ESDVWAYGVVLWEIFSYGLQPYYGMAHEEVIYYVRDGNILACPENCPLELYNLMRLCWSK
LPADRPSFCSIHRILQRMCERAEGTVGV
NT seq 2607 nt   +upstreamnt  +downstreamnt
atgagagagctcgtcaacattccactgttacagatgctcaccctggttgccttcagcggg
accgagaaacttccaaaagcccctgtcatcaccacgcctcttgaaactgtagatgcctta
gttgaagaagtggcgactttcatgtgcgccgtggaatcctaccctcagcctgaaatttct
tggaccagaaataaaattctcatcaagctgtttgacacccgctacagcatccgagagaac
ggtcagctcctcaccatcctgagtgtggaggacagtgatgatggcatctactgctgcaca
gccaacaatggagtgggaggagcggtggaaagttgtggcgccctgcaagtgaagatgaag
cctaaaataactcgtcctcccatcaatgtaaaaataattgagggattgaaagcagtccta
ccgtgcactacgatgggtaaccccaagccatccgtgtcctggattaagggggacagtgct
ctcagggaaaattccaggattgcagttcttgaatctgggagtttaaggatccataatgtg
caaaaggaagacgcaggacagtaccgatgtgtggcaaaaaacagcctgggcacagcttac
tccaaactggtgaagctggaagtggaggtttttgcaagaatcctgcgtgctcctgaatcc
cacaatgtcacctttggttcctttgtaaccctacgctgcacagcaataggcatgcctgtc
cccaccatcagctggattgaaaacggaaatgctgtttcttcaggttccattcaagagaat
gtgaaagaccgagtgattgactcaagactccagctctttatcacaaagccaggactctac
acatgcatagctaccaataagcatggagagaaattcagtaccgcaaaggctgcagccact
gtcagtatagcagaatggagcaaatcacagaaagaaagcaaaggctactgtgcccagtac
agaggggaggtgtgtgatgccgtcctggtgaaagactctcttgtcttcttcaacacctcc
tatcccgaccctgaggaggcccaagagctgctgatccacactgcgtggaatgaactcaag
gctgtgagcccactctgccgaccagctgccgaggctctgctgtgtaatcacctcttccag
gagtgcagctctggagtgctacctactcctatgcccatttgcagagagtactgcttggca
gtaaaggagctcttctgtgcaaaggaatggctggcaatggaagggaagacccaccgcgga
ctctacagatccgggatgcatttcctcccggtcccggagtgcagcaagcttcccagcatg
caccaggaccccacagcctgcacaagactgccgtatttagattataaaaaagaaaacata
acaacattcccgtccataacgtcctccaagccgagcgtggacattccaaacctgcctgcc
tccacgtcttccttcgccgtctcgcctgcgtactccatgactgtcatcatctccatcatg
tcctgctttgcggtgtttgctctcctcaccatcactactctctattgctgccgaaggagg
agagagtggaaaaataagaaaagagagtcggcagcggtgaccctcaccacattgccttcc
gagctcctgctggacaggctgcatcccaaccccatgtaccagaggatgccactccttctg
aatcccaagttgctcagcctggagtatccgaggaataacatcgagtatgtcagagacatc
ggagagggagcgtttggaagggtctttcaagcgagggccccaggcttgcttccttatgaa
cccttcactatggtggctgtgaagatgctgaaggaggaggcctccgcagatatgcaggca
gactttcagagggaggcagccctcatggcggagtttgacaaccccaacattgtgaagctc
ttaggtgtgtgtgctgttgggaagccaatgtgcctgctctttgaatatatggcctatggt
gacctcaatgagttcctccgaagcatgtcccctcacactgtgtgcagcctcagccacagt
gacctgtccacgagggctcgggtgtccagccctggtcctccacccctgtcttgtgcggaa
cagctctgtattgccaggcaagtggcagctggcatggcctacctgtcggagcgcaagttt
gtccatcgggacttagctaccaggaactgcctggttggagagaacatggtggtgaaaatt
gcagactttggcctctctaggaacatctactccgcagactactacaaagctgatggaaac
gatgctatacctatccgctggatgccacccgagtctatcttctacaaccgctacaccacg
gagtcagatgtgtgggcttatggcgtggtcctctgggagatcttctcctatggactgcag
ccctactatggaatggcccatgaggaggtcatttactatgtgagagatggtaacatcctt
gcctgccctgagaactgtcccttggaactgtacaaccttatgcgcctatgttggagcaag
ctgcctgcagacagacccagcttctgcagtatccaccggatcctgcagcgcatgtgcgag
agagcagagggaacggtaggcgtctaa

DBGET integrated database retrieval system