KEGG   Rattus norvegicus (rat): 81738
Entry
81738             CDS       T01003                                 

Gene name
Nup98
Definition
(RefSeq) nucleoporin 98
  KO
K14297  nuclear pore complex protein Nup98-Nup96
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03013  RNA transport
rno05014  Amyotrophic lateral sclerosis
rno05164  Influenza A
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    81738 (Nup98)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    81738 (Nup98)
  09172 Infectious disease: viral
   05164 Influenza A
    81738 (Nup98)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:rno03019]
    81738 (Nup98)
   03036 Chromosome and associated proteins [BR:rno03036]
    81738 (Nup98)
Messenger RNA biogenesis [BR:rno03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     81738 (Nup98)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Spindle formation proteins
    81738 (Nup98)
SSDB
Motif
Pfam: Nup96 Nucleoporin2 Nucleoporin_FG ANAPC3
Other DBs
NCBI-GeneID: 81738
NCBI-ProteinID: NP_112336
RGD: 71033
Ensembl: ENSRNOG00000020347
UniProt: P49793
Position
1q32
AA seq 1816 aa
MFNKSFGTPFGGGTGGFGTTSTFGQNTGFGTTSGGAFGTSAFGSSNNTGGLFGNSQTKPG
GLFGTSSFSQPATSTSTGFGFGTSTGTSNSLFGTANTGTSLFSSQNNAFAQNKPTGFGNF
GTSTSSGGLFGTTNTTSNPFGNTSGSLFGPSSFTAAPTGTTIKFNPPTGTDTMVKAGVST
NISTKHQCITAMKEYESKSLEELRLEDYQANRKGPQNQVGAGTTTGLFGSSPATSSATGL
FSSSTTNSAFSYGQNKTAFGTSTTGFGTNPGGLFGQQNQQTTSLFSKPFGQATTTPNTGF
SFGNTSTLGQPSTNTMGLFGVTQASQPGGLFGTATNTSTGTAFGTGTGLFGQPNTGFGAV
GSTLFGNNKLTTFGTSTTSAPSFGTTSGGLFGNKPTLTLGTNTNTSNFGFGTNNSGSSIF
GSKPAAGTLGTGLGTGFGTALGAGQASLFGNNQPKIGGPLGTGAFGAPGFNTSTAILGFG
APQAPVALTDPNASAAQQAVLQQHLNSLTYSPFGDSPLFRNPMSDPKKKEERLKPTNPAA
QKALTTPTHYKLTPRPATRVRPKALQTTGTAKSHLFDGLDDDEPSLANGAFMPKKSIKKL
VLKNLNNSNLFSPVNHDSEDLASPSEYPENGERFSFLSKPVDENHQQDGDDDSLVSRFYT
NPIAKPIPQTPESAGNKNNSSSNVEDTFIALNMRAALRNGLEGSSEETSFHDESLQDDRD
EIENSAFQIHPAGIVLTKVGYYTIPSMDDLAKITNEKGECIVSDFTIGRKGYGSIYFEGD
VNLTNLNLDDIVHIRRKEVIVYVDDNQKPPVGEGLNRKAEVTLDGVWPTDKTSRCLIKSP
DRLADINYEGRLEAVSRKQGAQFKEYRPETGSWVFKVSHFSKYGLQDSDEEEEEHPPKTT
SKKLKTAPLPPAGQATTFQMTLNGKPAPPPQSQSPEVEQLGRVVELDSDMVDITQEPVPD
SVLEESVPEDQEPVSASTQIASSLGINPHVLQIMKASLLVDEEDVDAMEQRFGHFPSRGD
TAQEICSPRLPISASHSSKSRSIVGGLLQSKFASGTFLSPSASVQECRTPRTSSLMNVPS
TSPWSVPLPLATVFTVPSPAPEVPLKTVGIRRQPGLVPLEKSITYGKGKLLMDMALFMGR
SFRVGWGPNWTLANSGEQLHGSHELENHQVAESMEYGFLPNPVAVKSLSESPFKVHLEKL
GLRQRKLDEDLQLYQTPLELKLKHSTVHVDELCPLIVPNPGVSVIHGYADWVKKSPRDLL
ELPIVKHWSLTWTLCEALWGHLKELDSQLDEPSEYIQTLERRRAFSRWLSHTAAPQIEEE
VSLTRRDSPIEAVFSYLTGSRISEACCLAQQSGDHRLALLLSQLVGSQSVRELLTMQLAD
WHQLQADSFIHDERLRIFALLAGKPVWQLSEQKQINVCSQLDWKRTLAIHLWYLLPPTAS
ISRALSMYEEAFQNTCEGDKYACPPLPSYLEGSGCVVEEEKDPQRPLQDVCFHLLKLYSD
RHYGLNQLLEPRSITADPLDYRLSWHLWEVLRALNYTHLSEQCEGVLQASYAGQLESEGL
WEWAIFVFLHIDNSGMREKAVRELLTRHCQLSETPESWAKETFLTQKLCVPAEWIHEAKA
VRAHMESNKHLEALYLFKAGHWNRCHKLVVRHLASDAIINENYDYLKGFLEDLAPPERSS
LIQDWETSGLVYLDYIRVIEMLHRIQQVDCSGYELEHLHTKVTSLCNRIEQIPCYNAKDR
LAQSDMAKRVANLLRVVLSLQHTPDATSNSTPDPQRVPLRLLAPHIGRLPMPEDYALEEL
RGLTQSYLRELTVGSQ
NT seq 5451 nt   +upstreamnt  +downstreamnt
atgtttaacaaatcatttggaaccccctttgggggtggtacagggggctttggtacaacg
tcaacatttggacaaaatactggctttggtactactagtggaggagcatttggaacatct
gcatttggttctagcaataatactggaggcttatttggtaattcacagaccaaaccagga
ggactgtttggtaccagttcatttagccagccagcaacctccacaagcactggttttggg
tttggcacatcaacaggaacatcaaatagtttgtttggaactgcaaatacagggaccagt
cttttctcatcccagaacaatgcatttgcacaaaataaaccaactggatttgggaatttt
ggaaccagtactagcagtggaggactctttggaactacaaataccacctctaatcctttt
ggtaacacatctggctccctctttgggccaagtagttttacagcagcacctacaggaact
accatcaaatttaatcctcccactggtacagatactatggtcaaagctggagttagcact
aacatcagcaccaagcatcagtgtattactgccatgaaagaatatgaaagcaagtcatta
gaggagcttcgtttggaggactatcaggctaaccggaaaggcccacagaaccaagtgggg
gcaggtaccacaactggcttatttgggtcttctccagcgacttccagtgcaacaggactc
ttcagctcttccaccactaattcagccttttcatatggtcagaacaaaactgcctttgga
actagcacaactggatttgggacaaatccaggtggcctctttggccaacagaatcaacag
actaccagtctcttcagcaaaccatttggccaggctacaaccaccccaaatactggcttt
tcctttggtaataccagcacccttggacaaccaagcaccaatactatgggcctatttgga
gtaacccaagcctcacagccaggaggtctttttgggaccgctacaaacaccagcactggg
acagcatttgggacaggaacaggtctctttgggcagcccaatactggatttggtgcagtt
ggttcgacgctgtttggcaataacaagcttacaacttttggaaccagcacaaccagtgct
ccctcatttggtacaaccagtggcgggctcttcggtaacaaaccaaccctgactttagga
accaatacaaacacttccaattttggttttggcacaaataacagtgggagtagtattttt
ggaagtaagccagcagccgggactctgggaacaggacttggtacaggatttggaacagct
cttggtgctggacaggcatctttgtttggaaacaaccaacctaagattggagggcctctt
ggtacaggagcctttggggcccctggatttaatacttcgactgccattttgggctttggc
gccccccaggccccagtagctttgacagatccaaatgcttctgctgcccagcaggctgtt
ctccagcagcacctcaatagtctaacatactcaccctttggagactcccctctcttccgg
aatcctatgtcagatcctaagaagaaagaagagagactgaaaccaaccaatccagcagct
cagaaagctcttacaacccctactcattataaacttacacctcgccctgccaccagagtc
agaccaaaggctttgcaaacaacaggtacagccaaatcacatctctttgatgggctggat
gacgatgaaccatctctagccaacggagcgtttatgcctaaaaagagcatcaagaagttg
gttttgaaaaatcttaacaatagcaatctcttttctcctgttaatcatgattcagaagat
ctagcttcaccctctgagtatccagaaaatggagagagattcagcttcctgagcaaacct
gttgatgagaaccatcagcaggatggagatgatgactctcttgtatcacgattttacact
aatcctattgccaaacctattccacaaactccagagagtgctggaaacaaaaataacagt
agcagcaatgtggaagacactttcattgctttgaacatgcgtgctgctttgcgaaatgga
ctggaaggaagcagtgaagaaacgtctttccatgatgagtcattgcaagatgaccgagac
gagatagaaaacagtgctttccaaatccatccagcaggcattgttctcacaaaagttggt
tattatactattccatctatggatgaccttgctaaaattaccaatgagaaaggagaatgc
attgtttctgacttcaccattggccgtaaagggtatggctcaatctattttgaaggagat
gtgaatttgacaaatctaaatttggatgacattgtgcatatccggaggaaagaagttatt
gtctatgtagatgataaccaaaagccacctgtgggtgaaggactaaataggaaggctgaa
gttactttggatggagtttggccaacagataaaacatcccggtgtttaataaagagtcca
gatcgacttgctgatatcaattatgaggggagattagaagcagtctcaagaaagcaaggg
gcccaattcaaggagtatcggcctgaaactggttcttgggtgtttaaggtttcccatttt
tctaagtatggccttcaggattctgatgaagaggaggaggaacacccacccaaaactact
tcaaagaagctgaagactgcccctttgccccctgcaggccaggcaaccactttccagatg
actcttaatggcaaacctgcacccccacctcagagccagagcccagaagtggagcagtta
gggagggttgtggagctggacagcgacatggtagatatcacgcaggagccagttccggat
tcggtgttagaagagagtgtacctgaggatcaggagcccgtgtccgcatcaacacagatc
gcgtcttcactgggaattaatccacatgtgttacagatcatgaaagcatccttgcttgtg
gatgaagaagacgtagatgccatggagcagcgcttcggtcacttcccttccagaggagac
actgctcaggagatctgctcccctagactccccatttcagcctcccactcctcaaaatcc
cgctccatagttggtgggttgctccaatcaaaatttgcaagtggaacttttctttcacca
agtgcctccgtgcaagaatgtcgcacacccagaacatcatctctaatgaacgtcccatcc
acatccccctggtctgtccctctacccctggccactgtgttcacagtgcccagcccagcc
cctgaagttcccctaaaaacagtggggatacgcaggcaaccaggcctagtccctcttgaa
aaatccattacatatggcaagggaaaactcttgatggacatggccttattcatgggacgt
tcatttcgggttggctggggtcccaactggactcttgcaaatagtggagaacaactgcat
ggctctcatgaactggaaaatcatcaggttgccgagtctatggaatacggattcctgccc
aatccagtagctgttaaatctctatctgaatccccattcaaagttcatttggaaaaactc
ggcttgagacagaggaagctggatgaggatctgcagttataccagacacctctagagctc
aaattaaaacatagcactgtgcatgtagatgagctgtgtcctctcatcgtccccaatcct
ggggtttcagtcattcatggttatgcagattgggttaagaaatcacccagagatttactg
gaactaccaattgtgaagcactggagcctgacgtggacattatgtgaagccctatggggc
cacctgaaggagcttgacagccagctggatgagcccagtgaatacattcagactctggag
cggagaagagctttttcccgctggctgtcccacactgctgcacctcagatagaagaggaa
gtctccttaacccgcagagacagtcccatagaggctgtcttcagctacctcacgggcagt
agaattagtgaggcctgttgtctggcacagcagtcaggtgatcatcgccttgcccttctt
ctgtctcagctggtgggaagccagtcagtccgggagctgctcaccatgcagttggctgat
tggcatcagctccaggctgactccttcatccacgatgagcggttgcgcatatttgccctg
ttagctggaaaaccggtgtggcagctctcagaacagaaacaaatcaatgtatgctcccag
ctagattggaaacgaacacttgctatccatctttggtatttgcttccaccaactgcctcc
atttccagggctctcagcatgtatgaagaagcatttcagaatacttgtgagggtgataaa
tatgcctgtccccctcttccttcttacctggagggcagtggctgtgtggtagaggaagaa
aaagacccccagagaccacttcaagacgtttgctttcatcttctaaagctctacagtgac
agacattatggtctcaatcagctcttggaaccccgaagcataactgcagatcctttggac
taccgcctaagctggcacctttgggaagtgctccgtgctcttaactatacacatctctca
gaacagtgtgagggcgtgctacaggccagttatgctggccagctggaaagtgaaggactc
tgggagtgggccatctttgtctttctgcacattgacaactcaggcatgcgtgagaaggct
gttcgagaactgctgacccggcactgccaactctcagagacccctgagtcttgggctaag
gagactttccttactcagaagctttgtgtgcctgctgagtggattcatgaggccaaagca
gttcgtgcacacatggaatccaataagcacttggaggccctctatttatttaaagctggt
cactggaaccgctgccacaaactagtcgttcggcacctagcttctgatgccattattaat
gagaactatgactacctgaaaggtttcttagaagatctggcacctccagagcgcagcagc
ctaattcaggactgggaaacatctgggcttgtttacttggattacattcgagtaattgaa
atgctccaccgtattcagcaggtggattgctcaggctatgaactagagcacttacatacc
aaagtgacttcactgtgtaaccggatagagcagattccgtgctacaatgccaaggatcgc
ctggctcagtcagatatggccaagcgggtagccaacttactgcgggtagttctgagcctt
cagcacactcctgacgccacctccaactccactccggaccctcagcgagtccctttgcgt
cttttggctccccacattggcaggctccctatgcctgaggactatgccttggaggaactg
cgaggccttacccagtcctaccttcgagaactgactgttgggagccaatga

DBGET integrated database retrieval system