KEGG   Rattus norvegicus (rat): 81821
Entry
81821             CDS       T01003                                 

Gene name
Dgkz
Definition
(RefSeq) diacylglycerol kinase zeta
  KO
K00901  diacylglycerol kinase (ATP) [EC:2.7.1.107]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00561  Glycerolipid metabolism
rno00564  Glycerophospholipid metabolism
rno01100  Metabolic pathways
rno04070  Phosphatidylinositol signaling system
rno04072  Phospholipase D signaling pathway
rno05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    81821 (Dgkz)
   00564 Glycerophospholipid metabolism
    81821 (Dgkz)
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    81821 (Dgkz)
   04072 Phospholipase D signaling pathway
    81821 (Dgkz)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    81821 (Dgkz)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.107  diacylglycerol kinase (ATP)
     81821 (Dgkz)
SSDB
Motif
Pfam: DAGK_acc DAGK_cat C1_1 Ank_2 Ank_4 Ank_3 Ank_5 Ank
Other DBs
NCBI-GeneID: 81821
NCBI-ProteinID: NP_112405
RGD: 70929
Ensembl: ENSRNOG00000017737
UniProt: O08560
Position
3q24
AA seq 929 aa
MEPRDPSPEARSSDSESASASSSGSERDADPEPDKAPRRLTKRRFPGLRLFGHRKAITKS
GLQHLAPPPPTPGAPCGESERQIRSTVDWSESAAYGEHIWFETNVSGDFCYVGEQYCVAK
MLPKSAPRRKCAACKIVVHTPCIGQLEKINFRCKPSFRESGSRNVREPTFVRHHWVHRRR
QDGKCRHCGKGFQQKFTFHSKEIVAISCSWCKQAYHSKVSCFMLQQIEEPCSLGVHAAVV
IPPTWILRARRPQNTLKASKKKKRASFKRRSSKKGPEEGRWRPFIIRPTPSPLMKPLLVF
VNPKSGGNQGAKIIQSFLWYLNPRQVFDLSQGGPREALEMYRKVHNLRILACGGDGTVGW
ILSTLDQLRLKPPPPVAILPLGTGNDLARTLNWGGGYTDEPVSKILSHVEEGNVVQLDRW
DLRAEPNPEAGPEERDDGATDRLPLDVFNNYFSLGFDAHVTLEFHESREANPEKFNSRFR
NKMFYAGTAFSDFLMGSSKDLAKHIRVVCDGMDLTPKIQDLKPQCIVFLNIPRYCAGTMP
WGHPGEHHDFEPQRHDDGYLEVIGFTMTSLAALQVGGHGERLTQCREVLLTTAKAIPVQV
DGEPCKLAASRIRIALRNQATMVQKAKRRSTAPLHSDQQPVPEQLRIQVSRVSMHDYEAL
HYDKEQLKEASVPLGTVVVPGDSDLELCRAHIERLQQEPDGAGAKSPMCHPLSSKWCFLD
ATTASRFYRIDRAQEHLNYVTEIAQDEIYILDPELLGASARPDLPTPTSPLPASPCSPTP
GSLQGDAALPQGEELIEAAKRNDFCKLQELHRAGGDLMHRDHQSRTLLHHAVSTGSKEVV
RYLLDHAPPEILDAVEENGETCLHQAAALGQRTICHYIVEAGASLMKTDQQGDTPRQRAE
KAQDTELAAYLENRQHYQMIQREDQETAV
NT seq 2790 nt   +upstreamnt  +downstreamnt
atggagccgcgggaccccagccccgaggcccggagcagcgactcggagtcggcctccgcc
tcgtccagcggctccgagcgcgacgcggatccggagccggacaaggctccgcggcgctta
accaagaggcgcttcccggggctgcggctctttgggcacaggaaagccatcaccaagtcg
ggcctccagcacctggcaccccctcctcccacgcctggggccccgtgcggtgaatctgag
cggcagatccggagtactgtggactggagtgagtcagcagcgtatggggagcacatctgg
tttgagaccaacgtgtccggagatttctgctatgtcggggagcagtactgtgtagctaag
atgctgccgaagtcagcgcccagaagaaagtgtgcagcctgtaagatcgtggtgcatacc
ccttgcatcgggcagctggaaaagatcaatttccgctgtaagccatccttccgtgaatca
ggctccaggaatgtccgtgagccaaccttcgtaagacaccactgggtccacaggcgacgc
caggatggcaagtgtcggcactgtgggaagggcttccagcagaagttcaccttccacagc
aaagagatcgtagctatcagctgttcctggtgcaaacaggcgtaccacagcaaggtgtcc
tgcttcatgctgcagcagattgaggagccctgttccctaggggtgcatgcagccgtggtc
atcccacccacctggatcctacgggcccggaggccccagaacaccctcaaggccagcaag
aagaaaaagagagcatccttcaaaaggagatccagtaagaaaggacctgaggaaggccgc
tggagacccttcatcatcaggcccaccccgtcccccctcatgaagcccctgctagtgttt
gtaaaccccaagagtgggggtaaccagggcgctaagatcatccagtcttttctgtggtat
ctgaacccccggcaagtcttcgatctgagccagggaggacccagggaagcgctggaaatg
taccgcaaagtccataatttgaggattctggcttgcgggggtgatggcacggttggctgg
attctttccaccctagaccagctgcgcttaaaaccaccacctcctgtggccatcctgccc
ctgggcactggcaatgacctggcccgaactctcaactggggtgggggttacacagatgag
ccagtgtcaaagatcctttcccatgtagaggaggggaacgtggtacagctggaccgttgg
gacctccgagcagagcccaaccctgaggcagggcctgaggagcgagatgacggagccact
gaccggctgcccctggatgtcttcaacaactacttcagtctgggctttgatgcccacgtc
accctggagtttcatgagtctcgagaagccaacccagagaagttcaacagccgctttcgg
aataagatgttctatgctgggacagccttctctgacttcctgatgggcagctccaaggac
ttagccaagcacatccgagtagtgtgtgacggaatggacctaacccccaagattcaggac
ctgaaaccgcagtgcatagtctttctgaatatccccaggtactgtgcaggcaccatgccc
tggggccaccctggggagcaccatgacttcgagccccagaggcacgatgatggctacctc
gaggtcatcggcttcaccatgacatccttggccgcattgcaggtgggtggacacggcgag
cggctgacccagtgccgagaagtgctgctcaccactgccaaggccatccctgtgcaggtg
gatggtgaaccctgcaagcttgcagcatcgcggattcgaattgccctgcgcaaccaggcc
actatggtgcagaaggccaagcgccggagtactgccccactgcacagcgatcagcagcca
gttcctgagcagctgaggatccaagtgagcagggtcagcatgcacgactacgaggctctc
cattatgacaaggagcagctcaaggaggcctctgtgcctctgggtactgtggtggtcccc
ggagacagtgacctagagctctgccgagcccacattgagagactccagcaggagcccgat
ggggctggagccaagtcccccatgtgccacccactgtcctccaagtggtgtttcctggac
gccaccactgccagccgcttctacaggatcgacagggcccaggagcacctcaactatgtg
acggagattgcccaggatgagatttatatcctagacccagagctgctgggtgcatcagcc
cgacctgacctccctacccctacctccccgctccctgcctccccctgctcccctacaccc
gggtcactgcagggggatgccgcactgccccaaggtgaagagctgattgaagctgccaag
aggaatgacttctgcaagctccaggaactacaccgagcaggaggtgacctcatgcaccgc
gaccatcagagccgcacactcctgcaccacgcagtcagcactggcagtaaggaagtggtc
cgctatctgctcgatcatgcaccaccagagatcctcgatgctgtggaggagaacggggag
acctgtctacaccaggcagccgccctaggtcagcgcaccatctgccactacattgtggaa
gccggggcctccctcatgaagacagatcagcagggcgacactcccaggcagcgagctgag
aaggctcaagacacagagctagctgcatacctggagaacagacaacattaccagatgatc
caacgtgaggaccaggagacagctgtgtag

DBGET integrated database retrieval system