KEGG   Rattus norvegicus (rat): 83469Help
Entry
83469             CDS       T01003                                 

Gene name
Lrp4, Megf7
Definition
(RefSeq) LDL receptor related protein 4
  KO
K20051  low-density lipoprotein receptor-related protein 4
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    83469 (Lrp4)
Membrane trafficking [BR:rno04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Low-density lipoprotein receptor (LDLR) family proteins
    83469 (Lrp4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ldl_recept_b Ldl_recept_a FXa_inhibition SGL DUF5050 cEGF EGF_CA
Motif
Other DBs
NCBI-GeneID: 83469
NCBI-ProteinID: NP_112612
RGD: 619731
Ensembl: ENSRNOG00000015285
UniProt: Q76LU2
Structure
PDB: 

Position
3q24
AA seq 1905 aa AA seqDB search
MRRWWGALLLGALLCAHGTASNLECACGRSHFTCAVSALGECTCIPAQWQCDGDNDCGDH
SDEDGCTLPTCSPLDFHCDNGKCIRRSWVCDGDNDCEDDSDEQDCPPRECEEDEFPCQNG
YCIRSLWHCDGDNDCGDNSDEQCDMRKCSDKEFRCSDGSCIAEHWYCDGDTDCKDGSDEE
SCPSAVPSPPCNLEEFQCAYGRRILDIYHCDGDDDCGDWSDESDCSSHQPCRSGEFMCDS
GLCVNAGWRCDGDADCDDQSDERNCTTSMCTAEQFRCRSGRCVRLSWRCDGEDDCADNSD
EENCENTGSPQCASDQFLCWNGRCIGQRKLCNGVNDCGDNSDESPQQNCRPRTGEENCNV
NNGGCAQKCQMIRGAVQCTCHTGYRLTEDGRTCQDVNECAEEGYCSQGCTNSEGAFQCWC
EAGYELRPDRRSCKALGPEPVLLFANRIDIRQVLPHRSEYTLLLNNLENAIALDFHHRRE
LVFWSDVTLDRILRANLNGSNVEEVVSTGLESPGGLAVDWVHDKLYWTDSGTSRIEVANL
DGAHRKVLLWQSLEKPRAIALHPMEGTIYWTDWGNTPRIEASSMDGSGRRIIADTHLFWP
NGLTIDYAGRRMYWVDAKHHVIERANLDGSHRKAVISQGLPHPFAITVFEDSLYWTDWHT
KSINSANKFTGKNQEIIRNKLHFPMDIHTLHPQRQPAGKNRCGDNNGGCTHLCLPSGQNY
TCACPTGFRKINSHACAQSLDKFLLFARRMDIRRISFDTEDLSDDVIPLADVRSAVALDW
DSRDDHVYWTDVSTDTISRAKWDGTGQKVVVDTSLESPAGLAIDWVTNKLYWTDAGTDRI
EVANTDGSMRTVLIWENLDRPRDIVVEPMGGYMYWTDWGASPKIERAGMDASNRQVIISS
NLTWPNGLAIDYGSQRLYWADAGMKTIEFAGLDGSKRKVLIGSQLPHPFGLTLYGQRIYW
TDWQTKSIQSADRLTGLDRETLQENLENLMDIHVFHRQRPPVTTPCAVENGGCSHLCLRS
PSPSGFSCTCPTGINLLLDGKTCSPGMNSFLIFARRIDVRMVSLDIPYFADVVVPINMTM
KNTIAIGVDPLEGKVYWSDSTLHRISRASLDGSQHEDIITTGLQTTDGLAVDAIGRKVYW
TDTGTNRIEVGNLDGSMRKVLVWQNLDSPRAIVLYHEMGFMYWTDWGENAKLERSGMDGS
DRTVLINNNLGWPNGLTVDKTSSQLLWADAHTERIEVADLNGANRHTLVSPVQHPYGLTL
LDSYIYWTDWQTRSIHRADKSTGSNVILVRSNLPGLMDIQAVDRAQPLGFNKCGSRNGGC
SHLCLPRPSGFSCACPTGIQLKGDGKTCDPSPETYLLFSSRGSIRRISLDTDDHTDVHVP
VPGLNNVISLDYDSVDGKVYYTDVFLDVIRRADLNGSNMETVIGHGLKTTDGLAVDWVAR
NLYWTDTGRNTIEASRLDGSCRKVLINNSLDEPRAIAVFPRKGYLFWTDWGHIAKIERAN
LDGSERKVLINADLGWPNGLTLDYDTRRIYWVDAHLDRIESADLNGKLRQVLVSHVSHPF
ALTQQDRWIYWTDWQTKSIQRVDKYSGRNKETVLANVEGLMDIIVVSPQRQTGTNACGVN
NGGCSHLCFARASDFVCACPDEPDSHPCSLVPGLMPPAPRATSLNEKSPVLPNTLPTTLH
SSTTRTRTSPEGAEGRCSERDAQLGLCAHSNEAVPAAPGEGLHVSYAVGGLLSVLLILLV
TAALMLYRHRKSKFTDPGMGNLTYSNPSYRTSTQEVKIEAAPKPAMYNQLCYKKEGGPDH
SYTKEKIKIVEGIHLLAGHDAEWGDLKQLRSSRGGLLRDHVCMKTDTVSIQASSGSLDDT
ETEQLLQEEQSECSSVHTATTPERRGSLPDTGWKHERKLSSESQV
NT seq 5718 nt NT seq  +upstreamnt  +downstreamnt
atgaggcggtggtggggcgcgctgctgctcggcgccctgctctgcgcacacggcacagcc
agcaatctggagtgtgcgtgtggtcggagccacttcacatgtgcagtgagcgcgctcggc
gaatgtacctgcatccccgcccagtggcagtgtgatggtgacaatgactgtggagaccac
agcgatgaggatggctgtacgctgcctacctgttcccctctggacttccactgtgacaac
ggcaagtgcatccgacgctcctgggtgtgtgatggggacaatgactgtgaagatgactcc
gatgagcaggactgtcccccccgggagtgtgaggaggacgagttcccctgccagaacggc
tactgcatccggagtctgtggcactgtgatggggacaatgactgtggtgacaacagtgac
gaacagtgcgacatgcgcaagtgctcagacaaggaattccgctgcagtgatgggagctgc
attgctgagcattggtactgtgatggagacacagactgcaaagacggctctgatgaggaa
agctgcccctcagcagtaccctctcctccttgcaacctggaagagttccagtgtgcctac
ggccgccgcatccttgacatctaccactgtgacggggatgatgactgcggagactggtca
gacgagtccgactgctcctcccaccagccctgccgctctggggaattcatgtgtgacagt
ggcctgtgcgtcaacgcaggctggcgctgtgatggtgatgcggactgcgatgaccagtct
gatgaacgtaactgcaccacctccatgtgcacagctgaacagtttcgctgtcggtcaggc
cgctgtgtccgtctgtcctggcgctgtgatggggaggatgactgcgcggacaacagtgat
gaagaaaactgtgagaacacaggaagcccccaatgcgcctctgaccagttcctgtgttgg
aatgggcgttgtattgggcagaggaagctctgcaatggggtcaatgactgcggcgacaac
agtgacgaaagcccacagcagaactgtcggccccggacgggtgaggagaactgcaatgtt
aacaacggtggctgtgcccagaagtgtcagatgattcgaggggcagtgcagtgtacctgc
cacacaggctaccggctcacagaggatgggagaacgtgccaggatgtgaatgaatgtgct
gaggagggatactgcagccagggctgcacaaacagcgaaggggctttccagtgctggtgc
gaagccggttatgagctgcggcccgatcggcgcagctgcaaggctctggggccggaacct
gtgctactgtttgccaatcgcatcgacatccggcaggtgctcccgcaccgctccgaatac
acgctgctactgaacaacctggagaacgccattgcccttgactttcatcatcggcgggag
ctggtcttctggtctgatgtcaccctggaccgcatcctccgtgccaaccttaatggcagc
aatgtggaggaggtggtgtctactgggctagagagcccaggcggcttggctgtggattgg
gtccatgacaagctctactggactgactccgggacgtcgaggattgaggtggctaatctg
gacggggcccaccggaaggtgctgctgtggcagagcctggagaagcccagggccattgcc
ctgcaccccatggagggaaccatctattggacagactggggcaacaccccccgcatcgag
gcctccagcatggacggctctggacgtcgcatcattgctgacactcatcttttctggccc
aacggcctcaccatcgactacgctggacgccgtatgtactgggtggacgctaagcaccac
gtcatcgagagagccaatctagatgggagtcaccgcaaggctgtcattagccagggcctc
ccacatccctttgccatcacagtgtttgaagacagcttgtattggacagactggcacacc
aagagcatcaatagtgccaacaagttcactgggaagaaccaggagatcattcgcaacaag
ctccactttcctatggacattcataccttgcacccccagcgccagcctgcagggaaaaac
cgctgcggggacaacaacggaggttgcactcacctgtgtctacccagtggccagaactac
acttgtgcctgccccaccggcttccgaaaaatcaacagccacgcctgtgcccagagtctt
gacaagttcctgctttttgcccgaaggatggacatccgtcggatcagcttcgacacagag
gacctgtccgacgatgtcatcccactggctgacgtgcgcagtgctgtggcccttgactgg
gactcccgggatgaccacgtgtactggacagatgtcagcactgataccatcagcagggcc
aagtgggatggaacaggacagaaggtggtagttgacaccagtttggagagccctgctggc
ctggcaattgattgggtcaccaacaaactctactggacagatgcaggtacagaccggatt
gaagtggccaacacggacggcagcatgaggacagtgctcatctgggagaaccttgatcgt
cctcgggacatcgtggtagaacccatgggcgggtacatgtattggactgactggggtgca
agtcccaagattgaacgagctggcatggatgcctccaaccgacaagtcatcatctcttcg
aatctgacatggcctaatggattagctattgactatgggtcccagcggctgtactgggct
gatgccggcatgaagactattgaatttgctgggctggatggcagcaagaggaaggtacta
attggaagtcaactcccccaccctttcgggctgactctatacggacagcgcatctattgg
actgactggcagaccaaaagtatccaaagtgctgaccggctgactgggctagaccgggag
actctgcaggagaacctggagaatcttatggacatccatgtcttccaccgccagaggcct
ccagtgacgacaccatgtgctgtggagaatggcggctgcagccatttgtgtcttcggtcc
ccaagtccgagcggcttcagctgtacctgccccacaggtatcaacctgctgcttgatggc
aagacatgctcaccaggcatgaacagtttcctcatcttcgccaggaggattgatgttcgc
atggtctccttggacatcccttattttgctgatgtggtggtacccatcaacatgaccatg
aagaacaccattgccattggagtggacccgctggaaggaaaagtgtactggtctgacagc
acactgcacaggatcagccgtgccagcctggatggctcacagcacgaggacatcatcact
acaggtttgcagaccacagatggacttgcagtggatgccatcggccggaaagtgtattgg
acagacacgggaacgaatcggattgaagttggcaacctggatgggtctatgcggaaagtg
ttggtgtggcagaaccttgacagtccccgggccattgtgctataccatgaaatggggttc
atgtactggacagactggggggagaatgccaaactagagcgttccgggatggatggctca
gaccgtactgtgctcatcaacaacaacctagggtggcctaacggactgactgtggacaag
accagctcccaactgctgtgggctgatgcccatactgagagaattgaggtggctgacctg
aacggtgccaatcggcatacattggtgtcaccagtgcagcacccatatggcctcactctg
cttgactcttacatctactggactgactggcagacccgtagcatccaccgggccgacaag
agtactggcagcaatgttatcctcgtgaggtccaacctgccaggcctcatggacatccaa
gctgttgaccgggcacagccactgggttttaataagtgtggttcgagaaatggcggctgc
tcccacctctgtttacctcggccctctggtttctcctgtgcctgccccactggcattcag
ctgaagggggatgggaagacctgtgacccctctccggagacctacctgctcttctctagc
cggggctccattcgccgtatctcactggacaccgatgaccacacagacgtgcatgtccct
gttcctgggctcaacaatgtcatctccctagactatgacagtgtggatggaaaggtctat
tacacagacgtgttcctggatgttatcaggcgagcagacctgaatggcagcaacatggag
actgttattgggcatgggctgaagaccactgatgggctggcagtggactgggttgccaga
aacctgtactggacagatacaggccgaaataccatcgaagcatctcggctagatggttcc
tgtcgcaaagtgctaatcaacaacagtctggacgagccccgggccattgctgttttcccc
agaaaggggtacctcttctggacagactggggccacattgccaagattgaacgggcaaac
ctggatggttctgagaggaaggtcctcatcaatgcagacctaggctggcccaatggcctt
accttggactatgatacccgcaggatctactgggtagatgcacatctggatcggattgag
agtgctgacctcaatgggaagctgaggcaggtcttggtcagccatgtgtcccaccccttt
gccctcacacagcaggacaggtggatctactggacagactggcagaccaaatccatccag
cgtgtcgacaagtactcaggccgcaacaaggagacagtgctggccaatgtggagggactc
atggatatcatcgtggtgtcccctcaacggcagacagggaccaatgcctgtggtgtgaac
aatggtggctgtagccacctctgctttgccagagcctctgactttgtgtgcgcctgtcct
gatgagccagacagtcatccctgctccctcgtgcctggcctcatgcctcctgctcccaga
gctaccagcctgaatgaaaagagcccagtgctccccaacacattgcccaccaccttacat
tcttctaccaccaggacccgcacatctccagagggggcagaaggaagatgctctgaaagg
gacgcccagctgggcctctgtgcacattccaatgaagctgtacctgctgctccaggtgaa
ggactgcatgtcagctacgccgttggtggactcctcagcgtcctgctgattttgttggtg
actgcagctttgatgctatacagacacagaaaatccaaattcacggatcctggaatggga
aacctgacctacagcaacccctcctaccgaacttccactcaggaagtgaaaattgaagca
gctcccaaaccagccatgtataatcagctgtgctataagaaagagggtggacctgaccac
agctacaccaaggagaagatcaagattgtagagggaattcacctcctggctgggcatgat
gctgaatggggtgacctcaagcaactgcgcagctccagggggggccttctacgggatcac
gtatgcatgaagacagacacggtgtccatccaggccagctctggctccctagatgacacg
gagacagagcagctgctgcaggaagagcagtctgagtgtagcagtgttcacactgcaacc
actccagagagacggggctctctgccagacacaggctggaaacatgaacgcaagctctcc
tcagaaagccaggtctaa

DBGET integrated database retrieval system