KEGG   Rattus norvegicus (rat): 83505
Entry
83505             CDS       T01003                                 

Gene name
St3gal5
Definition
(RefSeq) lactosylceramide alpha-2,3-sialyltransferase
  KO
K03370  lactosylceramide alpha-2,3-sialyltransferase (sialyltransferase 9) [EC:2.4.99.9]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00604  Glycosphingolipid biosynthesis - ganglio series
rno01100  Metabolic pathways
Module
rno_M00069  Glycosphingolipid biosynthesis, ganglio series, LacCer => GT3
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00604 Glycosphingolipid biosynthesis - ganglio series
    83505 (St3gal5)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:rno01003]
    83505 (St3gal5)
Enzymes [BR:rno01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.99  Transferring other glycosyl groups
    2.4.99.9  lactosylceramide alpha-2,3-sialyltransferase
     83505 (St3gal5)
Glycosyltransferases [BR:rno01003]
 Terminal extension
  Sialyltransferase
   83505 (St3gal5)
SSDB
Motif
Pfam: Glyco_transf_29
Other DBs
NCBI-GeneID: 83505
NCBI-ProteinID: NP_112627
RGD: 620875
Ensembl: ENSRNOG00000010284
UniProt: Q68G12
Position
4
AA seq 387 aa
MPNEFTSAKLRSDCSRTSLQWYTQTQHKMRRPSLLLKDILKCMLVVFGVWLLYILKLNYT
AEECDMKKLNYVDPARIKRAHRNTQEVFQKECRPGHAKKTMDLLFKGKYSMDLEPFVQKI
PTASEAELKYDPPFGFRKFSSKVQSLLDMLPEHDFPEHLRAKHCKRCVVIGNGGILHGLE
LGHALNQFDVVIRLNSAPIEGYSEHVGNKTTIRMTYPEGAPLSDAEYYANDLFVAVLFKS
VDFKWLQAMVKNESLPFWIRLFFWKQVAEKIPLQPKHFRILNPVIIKETAFDILQYSEPQ
SRFWGHDKNIPTIGIIAIVLATHLCDEVSLAGFGYDLSQPRTPLHYFDSQCMGAMNWQVM
HNVTTETQFLQKLIKEGVVQDLSGGIH
NT seq 1164 nt   +upstreamnt  +downstreamnt
atgccaaatgagttcacctctgcaaagctgagaagtgattgctcaaggacctccctgcaa
tggtacacccagacccagcacaagatgagaagacccagcttgttattaaaagacatcctc
aagtgcatgttggttgtgtttggagtgtggctcctgtacatcctcaagttaaattacact
gctgaagaatgtgacatgaaaaaactgaattatgtagaccctgcccgaataaagagagct
catagaaacactcaggaagtctttcagaaggaatgtcgtcctgggcacgcgaagaaaact
atggatctgttatttaagggcaagtacagcatggacttggagcctttcgtgcagaagatc
cccacagccagtgaagctgagctcaagtatgacccgccttttggattccggaagttctcc
agtaaagtccagagcctcttggatatgctgcctgagcacgactttcctgaacacttgaga
gccaagcactgcaagcgctgtgtggttattgggaacgggggcatccttcacggactagag
ctgggccacgcactcaaccagttcgatgtggtaataaggttaaacagcgcaccaattgag
ggttattctgaacatgttggaaataaaactactataaggatgacttacccagagggtgct
ccactgtcggacgctgaatactacgctaatgacttgttcgttgctgttttatttaagagt
gttgatttcaaatggcttcaagcaatggtgaaaaatgaaagcctgccattttggattcgt
ctcttcttttggaagcaggtggcagaaaaaatcccactccagccaaagcatttcaggatt
ttgaacccagttatcatcaaagaaactgccttcgacatccttcagtactcagagcctcag
tcaagattctggggccatgataagaatatccccacgatcggcatcattgccattgtcttg
gccacgcatctgtgtgatgaagttagcctggcaggctttggatatgacctcagtcaacca
aggacccctctgcactactttgacagtcagtgcatgggcgccatgaactggcaagtcatg
cacaacgtgaccacagagacccagttcctccagaagctcatcaaggagggcgtggtgcag
gacctcagcgggggcatccactga

DBGET integrated database retrieval system