KEGG   Rattus norvegicus (rat): 83517
Entry
83517             CDS       T01003                                 

Gene name
Fcna, Fcn1
Definition
(RefSeq) ficolin A
  KO
K10104  ficolin
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04091 Lectins [BR:rno04091]
    83517 (Fcna)
Lectins [BR:rno04091]
 Ficolins
  83517 (Fcna)
SSDB
Motif
Pfam: Fibrinogen_C Collagen DAG_kinase_N
Other DBs
NCBI-GeneID: 83517
NCBI-ProteinID: NP_112638
RGD: 621221
Ensembl: ENSRNOG00000017063
UniProt: Q5M8B4
Position
3p13
AA seq 335 aa
MWWPMLWAFPVLLCLCSSQALGQESGACPDVKIVGLGAQDKVAVIQSCPSFPGPPGPKGE
PGSPAGRGERGLQGSPGKMGPAGSKGEPGTMGPPGVKGEKGERGTASPLGQKELGDALCR
RGPRSCKDLLTRGIFLTGWYTIYLPDCRPLTVLCDMDVDGGGWTVFQRRVDGSINFYRDW
DSYKRGFGNLGTEFWLGNDYLHLLTANGNQELRVDLREFQGQTSFAKYSSFQVSGEQEKY
KLTLGQFLEGTAGDSLTKHNNMAFSTHDQDNDTNGGKNCAALFHGAWWYHDCHQSNLNGR
YLPGSHESYADGINWLSGRGHRYSYKVAEMKIRAS
NT seq 1008 nt   +upstreamnt  +downstreamnt
atgtggtggcctatgctgtgggcctttccagtactgctctgtctctgttcctcccaggcc
ctgggtcaggagagtggtgcctgtccagatgttaagatcgtaggtctgggggcccaggac
aaggtggctgtcatccaaagttgccctagctttcctggcccacctggacccaaaggggag
cctggaagtcctgctgggagaggggaacggggcttacagggcagcccagggaagatggga
cccgccggcagcaaaggagagccaggaaccatggggcccccaggagtcaaaggggagaaa
ggagagagaggaactgcatcaccactgggtcagaaggagctgggagacgcactgtgccgg
agagggccccggagctgcaaagacttgctgacacgggggatcttcctgactggctggtac
accatctatcttcctgactgccggccactgactgtgctctgtgacatggatgtggatggt
gggggctggaccgtttttcaacgacgagtggatgggtccatcaacttctaccgagactgg
gattcctataaaagaggctttggcaacctgggcacagagttctggttgggtaatgactac
cttcacctgctcacagccaatgggaaccaagagctccgggttgacttaagagagttccaa
ggtcaaacctcctttgccaaatacagctcattccaggtatctggagaacaggagaaatac
aagctgaccttggggcagtttctggagggcactgcaggagactccctgacaaagcacaac
aacatggcattctcaactcatgaccaagataatgatacgaatggcgggaagaactgtgca
gctttgttccacggagcctggtggtaccacgactgtcaccagtccaacctcaacgggcgc
tacttgcctggctcccatgaaagttatgcggatggcatcaactggctaagtggccgaggc
caccgctactcctacaaggttgctgagatgaaaatccgggcatcataa

DBGET integrated database retrieval system