KEGG   Rattus norvegicus (rat): 83527Help
Entry
83527             CDS       T01003                                 

Gene name
Dbnl, Sh3p7, abp1
Definition
(RefSeq) drebrin-like
  KO
K20520  drebrin-like protein
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    83527 (Dbnl)
Membrane trafficking [BR:rno04131]
 Others
  Actin-binding proteins
   Nucleation-promoting factors (NPFs)
    83527 (Dbnl)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cofilin_ADF SH3_9 SH3_1 SH3_2 DBINO
Motif
Other DBs
NCBI-GeneID: 83527
NCBI-ProteinID: NP_001264140
RGD: 70941
Ensembl: ENSRNOG00000012378
UniProt: Q9JHL4
Position
14q21
AA seq 436 aa AA seqDB search
MAVNLSRNGPALQEAYVRVVTEKSPTDWALFTYEGNSNDIRVAGTGEGGLEELVEELNSG
KVMYAFCRVKDPNSGLPKFVLINWTGEGVNDVRKGACANHVSTMANFLKGAHVTINARAE
EDVEPECIMEKVAKASGANYSFHKESSCFQDVGPQAPVGSVYQKTNAVSEIKRVGKDNFW
AKAEKEEENRRLEEKRRAEEEKQRLEEERRERELQEAARREQRYQEQHRSAGPPSPSSRT
GELEQEVVSRSRQEWESAGQQAPHPREIFKQKERAMSTTSVSSSQPGKLRSPFLQKQFTQ
PEASYGREPTSPVSRPAAGVCEELAPSTPPSAQTDDEPTYEVPSEQETLYEEPPPVQQPG
AGSGHIDNYMQSQDLSGQGLCARALYDYQAADDTEISFDPENLITGIEVIDEGWWRGYGP
DGHFGMFPANYVELIE
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atggcggtgaacctgagccggaacgggccggcgctgcaggaggcctatgtgcgggtggtc
accgagaaatccccgaccgactgggctctttttacctatgaaggcaacagcaatgacatc
cgtgtggctggcacaggggagggaggcctggaggagctggtggaggagctcaacagcggg
aaggtgatgtacgccttctgcagggtgaaggaccccaactctggcctgcccaagtttgtc
ctcatcaactggacaggcgagggtgtgaatgatgtgcgaaaaggagcatgtgccaaccac
gtcagcaccatggccaacttcctaaagggtgcccatgtgaccatcaacgcacgggctgag
gaagatgtggagcctgagtgcatcatggagaaggttgccaaggcttctggggctaattac
agcttccataaggaaagcagctgcttccaggatgtggggcctcaggccccagtgggctct
gtgtaccagaagaccaatgccgtgtctgagatcaagagagttggcaaggataacttctgg
gccaaagctgagaaggaggaggagaaccgccgcctggaggagaagcggcgggctgaagag
gagaagcagcggctggaggaggagcggcgggagcgggagctgcaggaggctgcccgacgg
gaacaacgctaccaggaacagcacagatcagctggacccccaagcccttccagcaggaca
ggtgaactggagcaagaggtggtttcaaggagcagacaggaatgggagtctgctgggcag
caggccccacacccacgggagattttcaagcagaaggaaagggctatgtccaccacctct
gtctccagctctcagccaggcaagctgaggagccccttcctgcagaagcagttcactcaa
ccagaagcttcctatggccgagagcccacttctcctgtgtcacggcctgcagcaggtgtc
tgcgaggagctggcacccagcactccgccctcagcccagacagacgatgaacctacatat
gaagtgccctccgagcaggagaccctgtacgaggaaccaccaccggtccagcagccaggg
gctggctccggacacattgacaactacatgcagagccaggacctcagtgggcaaggactg
tgcgctcgggccttgtacgactaccaggcagctgacgacacggagatctcctttgaccct
gagaacctaatcacaggcatcgaggtgattgacgaaggctggtggcgtggctatgggcct
gacggccactttggcatgtttcctgccaactatgtggagctcatagagtga

DBGET integrated database retrieval system