KEGG   Rattus norvegicus (rat): 83572
Entry
83572             CDS       T01003                                 

Gene name
Pafah1b1, LIS1
Definition
(RefSeq) platelet-activating factor acetylhydrolase 1b, regulatory subunit 1
  KO
K16794  platelet-activating factor acetylhydrolase IB subunit alpha
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00565  Ether lipid metabolism
rno01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09103 Lipid metabolism
   00565 Ether lipid metabolism
    83572 (Pafah1b1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    83572 (Pafah1b1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    83572 (Pafah1b1)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Spindle formation proteins
    83572 (Pafah1b1)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   83572 (Pafah1b1)
SSDB
Motif
Pfam: WD40 ANAPC4_WD40 Nup160 LisH eIF2A Nucleoporin_N Pox_A_type_inc LisH_2
Other DBs
NCBI-GeneID: 83572
NCBI-ProteinID: NP_113951
RGD: 620331
Ensembl: ENSRNOG00000002755
Vega: OTTRNOG00000002069
UniProt: P63004
Position
10q24
AA seq 410 aa
MVLSQRQRDELNRAIADYLRSNGYEEAYSVFKKEAELDMNEELDKKYAGLLEKKWTSVIR
LQKKVMELESKLNEAKEEFTSGGPLGQKRDPKEWIPRPPEKYALSGHRSPVTRVIFHPVF
SVMVSASEDATIKVWDYETGDFERTLKGHTDSVQDISFDHSGKLLASCSADMTIKLWDFQ
GFECIRTMHGHDHNVSSVAIMPNGDHIVSASRDKTIKMWEVQTGYCVKTFTGHREWVRMV
RPNQDGTLIASCSNDQTVRVWVVATKECKAELREHEHVVECISWAPESSYSSISEATGSE
TKKSGKPGPFLLSGSRDKTIKMWDVSTGMCLMTLVGHDNWVRGVLFHSGGKFILSCADDK
TLRVWDYKNKRCMKTLNAHEHFVTSLDFHKTAPYVVTGSVDQTVKVWECR
NT seq 1233 nt   +upstreamnt  +downstreamnt
atggtgctgtcccagagacaacgagatgaactaaatcgagctatagcagattatcttcgt
tcaaatggctatgaagaggcatattccgtttttaaaaaggaagctgaactagatatgaat
gaagaattagataagaagtatgctggtcttttggaaaaaaaatggacatctgttattaga
ttacaaaaaaaggtaatggaattagaatcaaaactaaatgaagcaaaagaagaatttacg
tcaggtggtcctcttggtcagaaacgagacccaaaagaatggattccccgtccacctgag
aaatatgcattgagtggtcataggagtccagttactcgagtcattttccatcctgtgttc
agtgttatggtctctgcttcagaggatgctacaattaaggtgtgggattatgagactgga
gattttgagcgaactctcaaggggcatacagattctgtacaggacatttcctttgaccac
agtggcaaactcttggcttcctgttctgcagatatgacgattaaattatgggattttcag
ggttttgaatgcatcagaaccatgcacggccacgaccacaatgtctcttcagtagccatc
atgcctaatggagatcatatagtgtctgcctcaagggataaaactataaaaatgtgggaa
gtgcaaactggctactgtgtgaagacattcacaggacacagagaatgggtacgtatggtg
cggccaaatcaggacggcactctgatagccagctgttccaatgaccagactgtgcgtgta
tgggttgtagcaacaaaggaatgcaaagctgagctccgagaacacgaacatgtggtagaa
tgcatttcctgggctccagaaagttcatattcttccatctctgaagcaacaggatctgag
actaaaaaaagtggcaagcctggacccttcttgctatctggttccagagacaaaactatt
aagatgtgggacgtcagtactggcatgtgccttatgactctggtgggtcatgataattgg
gtacgtggagttctgttccattctggggggaagtttattttgagttgtgctgatgacaag
accctccgtgtatgggattacaagaacaagcgatgcatgaagaccctcaatgcgcatgaa
cactttgttacctccttggatttccataagacggcaccctatgtggttactggcagtgta
gatcaaacagtaaaggtgtgggagtgccgttga

DBGET integrated database retrieval system