KEGG   Rattus norvegicus (rat): 83618
Entry
83618             CDS       T01003                                 

Gene name
Rest
Definition
(RefSeq) RE1-silencing transcription factor
  KO
K09222  RE1-silencing transcription factor
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04550  Signaling pathways regulating pluripotency of stem cells
rno05016  Huntington disease
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    83618 (Rest)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05016 Huntington disease
    83618 (Rest)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    83618 (Rest)
Transcription factors [BR:rno03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 others
    83618 (Rest)
SSDB
Motif
Pfam: zf-H2C2_2 zf-H2C2_5 zf-C2H2 zf-C2H2_4 zf-C2H2_jaz
Other DBs
NCBI-GeneID: 83618
NCBI-ProteinID: NP_113976
RGD: 621069
Ensembl: ENSRNOG00000002074
UniProt: O54963
Position
14
AA seq 1069 aa
MATQVMGQSSGGGSLFNNSGNMGMALPNDMYDLHDLSKAELAAPQLIMLANVALTGEVNG
SCCDYLVGEERQMAELMPVGDNHFSDSEGEGLEESAELKGDPSGLDNMELRSLELSVVEP
QPVFEASAAPEVYSSNKDPAPEAPVAEDKCKNLKAKPFRCKPCQYEAESEEQFVHHIRVH
SAKKFFVEESAEKQAKARESGASPSEEGEFSKGPIRCDRCGYNTNRYDHYTAHLKHHLRA
GDNERVYKCIICTYTTVSEYHWRKHLRNHFPRKVYTCSKCNYFSDRKNNYVQHVRTHTGE
RPYKCELCPYSSSQKTHLTRHMRTHSGEKPFKCDQCNYVASNQHEVTRHARQVHNGPKPL
NCPHCDYKTADRSNFKKHVELHVNPRQFNCPVCDYAASKKCNLQYHFKSKHPTCPSKTMD
VSKVKLKKTKRREADLHRDAAAAATEQTDTEQAKTKGVDASARRSERPVKGVGKDVPKEK
KPCSNASVVQVTTRTRKSAVETKAAEGKHTDGQTGNNAEKSSKAKKSKRKMDAEAHPSAE
PVTEGPVTKKKKTESKPKTSGEVPKGSRVEDRKADKQQSASIKKGGKKTALKTKTAKKGS
KLAPKGVGHTEPSSEMAQGGESPVPALTQAVVTPSGSTQTELSSPMDIAQTEPAQMDVSQ
TGPPQVQRPLPVEPAQLEPSPPQEPPQVEPPACVEPPPPVEPPCPMEPAEMEPSPPMEPS
QVEPPPHLEPPLPMELPQVELPPVEDCQKELPSVEHAQTKVAQTGPTQVGAVQEEPLSVS
EPPQVKLTRRSSPRKDRAKEKLSVLSEMARQEQVLIEVGLVPVRDSQLLKASKSAPDLPA
PPSPLPKGHLRREETPKDQEMFSDGEGNKVSPLEKGGTEEAGESRAELAAPMESTSALSS
EQSSNAPDGETLHSECQADSTAVCEMEVDTEQKTDRVPLKDSAVEPVSPLNPRVDPEAAA
PAVVASPPITLAESQEIDEDEGIHSHDGSDLSDNMSEGSDDSGLHGARPAPQEATSKSGK
EGLAVKVTEGEFVCIFCDRSFRKEKDYSKHLNRHLVNVYFLEEAAEEQE
NT seq 3210 nt   +upstreamnt  +downstreamnt
atggccacccaggtgatggggcagtcttctggaggaggaagtctctttaacaacagtggc
aacatgggcatggccttacccaacgacatgtatgacttgcacgacctctcgaaagctgaa
ctggcggcacctcagctcattatgttagccaacgtggccctgactggggaagtgaatggc
agctgctgtgattacctggttggtgaagagagacagatggccgagttgatgcctgttgga
gacaaccacttttcagatagcgaaggagaaggccttgaggagtcggctgaactaaaaggt
gaccccagtgggctggacaacatggaactgagaagtttggagctaagcgttgtagagccc
cagcctgtatttgaagcatcagctgccccagaagtgtacagctcgaataaagatcccgcc
cctgaagcacccgtggcggaggacaaatgcaagaatttgaaggccaaacccttccgttgt
aagccatgccagtatgaagcggagtctgaagaacagttcgtacatcacatccgggttcac
agtgctaagaagttttttgtggaagagagtgcagagaagcaagccaaagccagggaatct
ggggcttccccgtctgaggagggcgagttctccaagggtcccatccgctgtgatcgctgt
ggctacaataccaaccggtatgatcactacacggcacacctgaagcaccacctgagagcc
ggggataacgagcgtgtctacaagtgtatcatttgcacgtacacgacggtcagcgaatac
cactggcggaaacacctgaggaaccattttcccaggaaagtctacacgtgtagcaagtgc
aactatttttccgacagaaaaaataattatgttcaacacgttcgaactcacacaggagaa
cgcccttataaatgtgaactgtgtccttactcaagttctcagaagactcatctaactcga
cacatgcgtactcactcaggtgagaagccatttaaatgtgatcagtgcaattatgtggcc
tctaatcagcacgaagtgacccgacacgcaagacaggttcacaacgggcctaaacctctt
aattgccctcactgtgactacaaaacagccgataggagcaacttcaagaagcacgtcgag
ctgcacgtcaaccctcggcagttcaactgccccgtgtgtgactacgcggcctccaagaag
tgtaacctgcagtaccatttcaagtccaagcaccccacctgccccagcaagacgatggac
gtgtccaaagtgaagctgaagaaaaccaagaggagggaggctgacctgcaccgtgacgcc
gccgccgccgccactgagcagacggacacagagcaagcgaaaaccaagggggtggacgcg
tctgcgaggagaagtgagaggcctgtaaaaggcgttggaaaagatgttccaaaagagaag
aagccctgtagcaatgcctctgtggtgcaggtaactacccgaactcggaaatcagcggtg
gagactaaagcagcggagggaaaacacacagatggacagacaggaaacaacgcagaaaag
tcctctaaagctaagaagagcaaaaggaagatggacgccgaggcccatccctcggctgaa
cctgtgactgagggacccgtgacaaagaagaaaaagacggagagcaaacccaagaccagc
ggcgaagtgccgaagggcagcagagtggaggacaggaaggcggacaaacagcaaagtgct
tccattaagaaaggcgggaagaagacggctctcaagactaagacagctaaaaaaggcagc
aaacttgctcctaagggggtggggcacacagaaccttcctcggagatggctcaaggaggg
gagtctccagttcctgctctcactcaggcggtggtcaccccatcaggatctactcagaca
gagctctcttctcccatggatattgctcagacagagcctgcccagatggacgtttcccag
acagggccgcctcaggtgcagcggcctcttcctgtggagcctgctcaattggagccgtct
cctcctcaggagcctccccaggtagagccacctgcctgtgtggagcctccccctcccgtg
gagcctccatgtcccatggagcctgctgagatggaaccgtcccctcccatggagccttcc
caggtggagccacctcctcatttggagcctccgcttcccatggagctgcctcaggtggag
ctgcctcctgtggaggattgtcagaaggagctgccttctgtggagcatgctcagactaag
gttgctcagacaggtcctactcaggtgggagctgttcaggaggagcccctttctgtctcc
gagccacctcaagtcaagctaaccagaaggtcatctccccggaaagaccgtgccaaggag
aagttgagcgtgctgagtgagatggcgaggcaggagcaggttcttattgaggttggctta
gtgcctgtcagagatagccagcttctgaaggccagcaagagcgcaccggacctcccagcc
ccaccgtcaccactgccaaagggacacttgagaagagaagagacacccaaggaccaagaa
atgttctctgacggggaaggaaataaagtatcccctctcgagaaaggaggaacagaggaa
gctggtgagagtcgagctgagctggctgctcccatggaatctaccagtgctttatcctct
gaacaaagctcaaatgcaccagatggtgaaacattacacagcgagtgtcaggctgactcc
actgcggtttgtgaaatggaagtggacactgagcagaagacagaccgtgtccctctgaaa
gactcagcagtagaaccagtgtcacctcttaacccaagagtggaccctgaagcagcggca
ccagctgtggtggcctcccctcctatcactttggccgagtctcaggaaattgatgaggat
gaaggcattcacagccatgatggaagtgacctgagcgacaacatgtctgaggggagtgat
gactcaggactgcatggggctcggccagcaccacaggaagctacgtcaaaaagtggaaag
gaagggttggctgtcaaagtaactgagggagagtttgtttgtattttttgtgatcgttct
tttagaaaggaaaaagactatagcaaacacctcaatcgccatttggtgaatgtgtacttc
cttgaagaagcagctgaggagcaggagtag

DBGET integrated database retrieval system