KEGG   Rattus norvegicus (rat): 83709Help
Entry
83709             CDS       T01003                                 

Gene name
Git1
Definition
(RefSeq) GIT ArfGAP 1
  KO
K05737  G protein-coupled receptor kinase interactor 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04144  Endocytosis
rno04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    83709 (Git1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    83709 (Git1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    83709 (Git1)
Membrane trafficking [BR:rno04131]
 Endocytosis
  Arf GTPases and associated proteins
   Arf associated proteins
    83709 (Git1)
 Endosome - Golgi transport
   Arf GTPase associated proteins
    83709 (Git1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GIT1_C GIT_CC ArfGap GIT_SHD Ank_2 Ank_4 Ank_5 Ank Shugoshin_N T7SS_ESX_EspC ZapB YabA
Motif
Other DBs
NCBI-GeneID: 83709
NCBI-ProteinID: NP_114002
RGD: 69331
Ensembl: ENSRNOG00000061270
UniProt: Q9Z272
Structure
PDB: 

Position
10q24
AA seq 770 aa AA seqDB search
MSRKGPRAEVCADCSAPDPGWASISRGVLVCDECCSVHRSLGRHISIVKHLRHSAWPPTL
LQMVHTLASNGANSIWEHSLLDPAQVQSGRRKANPQDKVHPIKSEFIRAKYQMLAFVHKL
PCRDDDGVTAKDLSKQLHSSVRTGNLETCLRLLSLGAQANFFHPEKGTTPLHVAAKAGQT
LQAELLVVYGADPGSPDVNGRTPIDYARQAGHHELAERLVECQYELTDRLAFYLCGRKPD
HKNGHYIIPQMADRSRQKCMSQSLDLSELAKAAKKKLQALSNRLFEELAMDVYDEVDRRE
NDAVWLATQNHSTLVTERSAVPFLPVNPEYSATRNQGRQKLARFNAREFATLIIDILSEA
KRRQQGKSLSSPTDNLELSARNQSDLDDQHDYDSVASDEDTDQEPLPSAGATRNNRARSM
DSSDLSDGAVTLQEYLELKKALATSEAKVQQLMKVNSSLSDELRKLQREIHKLQAENLQL
RQPPGPVPVPSLPSERAEHTLMGPGGSTHRRDRQAFSMYEPGSALKPFGGAPGDELATRL
QPFHSTELEDDAIYSVHVPAGLYRIRKGVSASSVTFTPSSPLLSSSQEGSRHASKLSRHG
SGAESDYENTQSGEPLLGLEGKRFLELSKEDELHAELESLDGDPDPGLPSTEDVILKTEQ
VTKNIQELLRAAQEFKHDSFVPCSEKIHLAVTEMASLFPKRPALEPVRSSLRLLNASAYR
LQSECRKTVPPEPGAPVDFQLLTQQVIQCAYDIAKAAKQLVTITTREKKQ
NT seq 2313 nt NT seq  +upstreamnt  +downstreamnt
atgtcccggaaggggccgcgagcggaggtgtgtgcggactgcagcgcccctgaccctggc
tgggcatctatcagcagaggtgtgctggtttgtgacgagtgctgcagtgtgcaccggagc
ctgggacgacacatctccattgtcaaacaccttcgccacagcgcctggcctcctacgctg
ctacagatggtgcacacgcttgccagcaacggggccaactctatctgggagcattccctg
ctggaccctgcacaagtgcaaagtggccggcgcaaagccaacccccaagacaaagtccac
cccatcaagtcagagttcatcagggcaaagtaccagatgctggcgtttgtgcacaagctt
ccctgccgtgatgatgatggggtcaccgccaaagacctcagcaagcaactgcactcgagt
gtgcgaacaggcaacctggagacctgtctgcgcctgctttccctgggtgcccaggccaac
ttcttccacccagaaaagggcactacacctctacacgtggctgccaaggcagggcagaca
ctgcaggctgagctgctagtagtgtatggggctgacccaggctcccctgatgtcaatggc
cgcacacccattgactatgccaggcaggcggggcaccatgaactggcagaaaggctagtt
gagtgccagtatgagctcactgaccggttggccttctacctctgtggacggaagcctgat
cacaagaatgggcattacatcataccacagatggctgacagatctcggcaaaagtgcatg
tctcagagtttggatctgtctgaattggccaaagctgccaagaagaagctacaagcactc
agcaaccggctctttgaggagctcgccatggatgtgtatgacgaagtggaccggagagaa
aatgatgcagtgtggctagctacccagaatcatagcaccctggtgacagaacgcagtgct
gtgcccttcctgccagtcaaccctgaatactcagccactcggaatcagggacgacagaaa
ttggctcgttttaatgcccgagagtttgccaccttgatcatcgacatcctcagtgaggcc
aaacggaggcagcagggcaagagtctgagcagccccacagacaacctcgagctgtctgca
cggaaccaaagtgacctggacgaccagcacgactacgatagtgtggcttctgacgaagac
acagaccaggagcccttgcccagtgctggcgccacgcggaacaatcgtgccaggagcatg
gactcctcagatctgtcggatggggctgtgacgctgcaggagtacctggagctgaagaag
gctctggctacctccgaggccaaagtgcagcagctcatgaaagtcaacagcagtctgagt
gacgagcttcggaagctgcagagggagatccacaaactgcaggcagagaacctgcagctc
cggcagccaccaggaccagtgcctgtaccctcacttcccagtgaacgggcagaacacaca
ctcatgggccctggtggaagtacccatcgcagggaccgccaggccttctctatgtatgag
ccaggctccgccctgaagccctttggaggtgcacctggggatgagctcgccacacggctc
cagcctttccacagcacagagctggaagatgatgccatctattcagtacatgtccctgct
ggcctttaccggatccggaagggggtgtctgcctcttctgtgaccttcactccctcctcc
ccactgctgtcaagctcccaagaaggaagtcgccatgcgagcaagctttcacgccacggc
agtggcgcagagagtgactatgagaacacacagagtggagagcctctgctgggacttgaa
gggaagcgattcctagagctgagcaaggaggatgagctgcacgctgagctggagagctta
gatggagacccagaccccgggctccccagcacagaagatgtcatcctaaagacagagcag
gtcaccaagaacattcaggagctattgcgggcagcccaggagttcaaacatgacagcttt
gtgccctgttcagaaaagatccatttggctgtgactgagatggcctctctcttcccaaag
aggccagccctggagcctgtgcgcagttcactgcggctgctcaacgccagcgcctaccgg
ctgcagagtgaatgccggaagacagtgcctccagaacctggcgcccctgtggacttccag
ctactgactcagcaggtgatccagtgcgcctatgacatcgccaaggctgccaagcagctg
gtcaccatcaccacccgagagaagaaacagtga

DBGET integrated database retrieval system