KEGG   Rattus norvegicus (rat): 83722
Entry
83722             CDS       T01003                                 

Gene name
Plk2, Snk
Definition
(RefSeq) polo-like kinase 2
  KO
K08861  polo-like kinase 2 [EC:2.7.11.21]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04068  FoxO signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    83722 (Plk2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    83722 (Plk2)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    83722 (Plk2)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.21  polo kinase
     83722 (Plk2)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: Other
  PLK family [OT]
   83722 (Plk2)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    83722 (Plk2)
   Centrosome duplication proteins
    Regulators of centriole replication
     83722 (Plk2)
  Sister chromatid separation proteins
   Polo kinases
    83722 (Plk2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr POLO_box Pkinase_fungal Kinase-like
Other DBs
NCBI-GeneID: 83722
NCBI-ProteinID: NP_114009
RGD: 620760
Ensembl: ENSRNOG00000011951
UniProt: Q9R012
Position
2q14
AA seq 682 aa
MELLRTITYQPAAGTKMCEQALGKACGGDSKKKRPQQPSEDGQSQAQVTPAAPHHHHHHS
HSGPEISRIIVDPTTGKRYCRGKVLGKGGFAKCYEMTDLTNNKVYAAKIIPHSRVAKPHQ
REKIDKEIELHRILHHKHVVQFYHYFEDKENIYILLEYCSRRSMAHILKARKVLTEPEVR
YYLRQIVSGLKYLHEQEILHRDLKLGNFFINEAMELKVGDFGLAARLEPLEHRRRTICGT
PNYLSPEVLNKQGHGCESDIWALGCVMYTMLLGRPPFETTNLKETYRCIREARYTMPSSL
LAPAKHLIASMLSKNPEDRPSLDDIIRHDFFLQGFTPDRLSSSCCHTVPDFHLSSPAKNF
FKKAAAALFGGKKDKARYNDTHNKVSKEDEDIYKLRHDLKKTSITQQPSKHRTDEELQPP
PTTFAKSGTSAVENKQQIGDAIRMIVRGTLGSCSSSSECLEDSTMGSVADTVARVLRGCL
ENMPEADCIPKEQLSTSFQWVTKWVDYSNKYGFGYQLSDHTVGVLFNNGAHMSLLPDKKT
VHYYAELGQCSVFPATDAPEQFISQVTVLKYFSHYMEENLMDGGDLPSVTDIRRPRLYLL
QWLKSDKALMMLFNDGTFQVNFYHDHTKIIICNQNEEYLLTYINEDRISTTFRLTTLLMS
GCSLELKHRMEYALNMLLQRCN
NT seq 2049 nt   +upstreamnt  +downstreamnt
atggagctcctgcggactatcacctaccagccggccgccggcaccaagatgtgcgagcag
gcgctgggcaaagcttgcggcggggactcaaagaagaagcgaccgcagcagccttctgaa
gacgggcagtcccaagcccaggtgaccccggcggccccacaccaccatcatcaccattct
cactccggacccgagatctcgcggattatagtcgaccccacgacggggaagcgctactgc
cggggcaaagtgctgggcaagggtggatttgcaaagtgttacgaaatgacagatctgaca
aacaacaaagtctacgctgcaaaaattatccctcacagcagagtagctaaacctcatcaa
agggaaaagatcgacaaagaaattgagcttcacagaatcctgcaccataagcatgtagtg
cagttttaccactactttgaagacaaagaaaacatttacatcctcttggagtactgcagt
agaaggtccatggctcatatcttgaaagcaagaaaggtgttgacagagccagaagtccga
tactacctcaggcagattgtgtcgggactcaagtatcttcacgaacaagaaatcttgcat
agggatctcaagctagggaacttttttattaatgaggccatggagctgaaggttggagac
ttcggcttggctgccagactggaacctttggaacacagaaggagaacaatatgtggaacc
ccaaattatctctcccctgaagtcctcaacaaacaaggacatggctgtgaatcagacatc
tgggccttaggctgtgtaatgtatacaatgctgctaggaagacctccattcgaaacaaca
aatctgaaagaaacgtacaggtgcataagagaagcaagatatacaatgccgtcttcatta
ctggcccccgccaagcacttgatagccagcatgctgtccaaaaacccagaggaccgcccc
agtttggatgacatcattcggcatgacttctttctgcagggcttcactccagacagactc
tcttctagctgttgccacacagttccagacttccacttgtcaagcccagctaagaatttc
tttaagaaagctgctgccgctctttttggtggcaaaaaggacaaagcaagatataatgac
acacacaataaagtgtctaaggaagatgaagacatctacaagcttcggcatgatttgaag
aaaacatcgataacccagcaacccagcaaacacagaacagatgaggagctccagcctcct
ccaactacctttgccaaatctgggacatccgcagtggaaaacaaacagcagattggagat
gcaatccggatgatagttagagggacgctgggcagctgcagcagcagcagtgaatgcctt
gaggatagcaccatgggaagtgttgcagacacagtggcaagagtccttcgagggtgtcta
gaaaacatgcctgaagctgactgtattcccaaagagcagttgagcacgtcctttcagtgg
gtcaccaaatgggtcgactactccaacaaatacggctttggataccagctctcagaccac
actgttggagtccttttcaacaacggcgctcacatgagcctccttccagacaaaaagaca
gttcactattatgcggaacttggccaatgctctgttttcccagcaacagatgcccccgaa
caatttattagtcaagtgacggtgctgaaatacttttcccactacatggaggagaacctc
atggatggtggcgatctccctagtgttactgacattcgaagacctcggctctacctcctt
cagtggttaaagtctgataaagccttaatgatgctcttcaatgacggcacatttcaggtg
aatttctaccacgatcatacaaagataattatctgtaaccaaaatgaagaataccttctc
acatacatcaacgaagacaggatatctacaactttcagactgacgaccctgttgatgtct
ggctgttcgctagaattgaaacatcgaatggaatacgccctgaacatgctcttgcagaga
tgtaactga

DBGET integrated database retrieval system