KEGG   Rattus norvegicus (rat): 83726
Entry
83726             CDS       T01003                                 

Gene name
Ctcf
Definition
(RefSeq) CCCTC-binding factor
  KO
K23195  transcriptional repressor CTCF
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    83726 (Ctcf)
   03036 Chromosome and associated proteins [BR:rno03036]
    83726 (Ctcf)
Transcription factors [BR:rno03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 others
    83726 (Ctcf)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Chromatin remodeling factors
   Other chromatin remodeling factors
    83726 (Ctcf)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 zf-H2C2_5 zf-C2H2_jaz zf-met zf-C2H2_6 zf-C2HE Actin_micro C1_1
Other DBs
NCBI-GeneID: 83726
NCBI-ProteinID: NP_114012
RGD: 621344
Ensembl: ENSRNOG00000017674
UniProt: Q9R1D1
Position
19q12
AA seq 737 aa
MEGEAVEAIVEESETFIKGKERKTYQRRREGGQEEDACHLPQNQTDGGEVVQDVNSSVQM
VMMEQLDPTLLQMKTEVMEGTVAPEAEAAVDDTQIITLQVVNMEEQPINIGELQLVQVPV
PVTVPVATTSVEELQGAYENEVSKEGLAESEPMICHTLPLPEGFQVVKVGANGEVETLEQ
GELPPQEDPSWQKDPDYQPPAKKTKKTKKSKLRYTEEGKDVDVSVYDFEEEQQEGLLSEV
NAEKVVGNMKPPKPTKIKKKGVKKTFQCELCSYTCPRRSNLDRHMKSHTDERPHKCHLCG
RAFRTVTLLRNHLNTHTGTRPHKCPDCDMAFVTSGELVRHRRYKHTHEKPFKCSMCDYAS
VEVSKLKRHIRSHTGERPFQCSLCSYASRDTYKLKRHMRTHSGEKPYECYICHARFTQSG
TMKMHILQKHTENVAKFHCPHCDTVIARKSDLGVHLRKQHSYIEQGKKCRYCDAVFHERY
ALIQHQKSHKNEKRFKCDQCDYACRQERHMIMHKRTHTGEKPYACSHCDKTFRQKQLLDM
HFKRYHDPNFVPAAFVCSKCGKTFTRRNTMARHADNCAGPDGVEGENGGETKKSKRGRKR
KMRSKKEDSSDSENAEPDLDDNEEEEEPAVEIEPEPEPQPQPQPQPQPQPVAPAPPPAKK
RRGRPPGRTNQPKQNQPTAIIQVEDQNTGAIENIIVEVKKEPDAEPAEGEEEEAQAAPAD
APNGDLTPEMILSMMDR
NT seq 2214 nt   +upstreamnt  +downstreamnt
atggaaggtgaggcggttgaagccattgtggaagagtctgaaactttcattaaaggaaag
gaaagaaagacttaccagagacgccgggaagggggccaggaagaagatgcttgccaccta
ccccagaaccagacagacgggggtgaggtggtccaggatgtcaacagtagcgtacagatg
gtaatgatggaacagctggaccctacccttctccaaatgaagactgaagtaatggagggg
acagtggctcctgaagcagaagctgcagtggacgatacccaaatcataaccctgcaggtt
gtaaacatggaggaacagcccattaatataggagaacttcagcttgtccaagtacctgtt
cctgtgactgtacctgttgctactacgtcagtagaagaacttcagggggcttatgagaat
gaagtgtctaaagagggccttgcagaaagtgaaccgatgatatgtcacaccttaccttta
cctgaaggatttcaggtggtaaaagtgggggccaatggagaagtggagacactagagcag
ggggagcttcctcctcaggaagaccctagctggcaaaaagacccagactatcagccacca
gccaaaaaaacaaagaaaaccaaaaagagtaaacttcgttacacagaggagggcaaagac
gtggatgtgtctgtgtatgattttgaggaagaacagcaggaaggactgctgtctgaggtt
aatgcagagaaagtggttggtaatatgaagcctccgaagccaacaaaaattaaaaaaaaa
ggtgtaaagaaaacattccagtgtgagctttgcagttacacgtgtccacggcgttcaaat
ttggatcgtcacatgaaaagccacactgatgagagaccacacaagtgccatctctgtggc
agagcattcagaacagtaaccctcctgaggaatcatcttaacacacacacaggtactcgt
cctcacaagtgccccgactgcgacatggcttttgtgaccagtggagagttggtgcggcat
cgtcgttataaacacactcatgagaaaccatttaagtgttccatgtgtgattatgccagt
gtagaagtcagcaaattaaaacgacacattcgctctcatactggagagcgcccgttccag
tgcagtttgtgcagttatgccagcagggacacatacaagctgaaaaggcatatgagaacc
cattcaggtgaaaaaccttatgaatgttatatttgtcatgctcggtttacccagagtggt
accatgaagatgcacattttacagaagcacacagaaaatgtggccaaatttcattgtccc
cactgtgacactgtcatagcccgaaaaagtgatttgggtgtccacttgagaaagcagcat
tcctatattgagcagggcaaaaaatgtcgctactgtgatgctgtgtttcatgagagatat
gctcttatccagcatcaaaaatcacacaaaaatgagaagcgcttcaagtgcgaccagtgt
gattatgcttgtagacaggagaggcacatgatcatgcacaagcgcactcacacgggggag
aagccttatgcctgcagccactgcgacaagaccttccgccagaaacagctccttgacatg
catttcaagcgctatcatgatcccaactttgtccccgctgcctttgtctgttctaagtgt
gggaaaacattcacacgccggaacacaatggcgagacacgcagataactgtgctggtcca
gacggtgtagaaggggaaaatggaggagagacaaagaagagcaaacgaggaagaaaaaga
aagatgcggtctaaaaaagaagactcctctgacagtgaaaatgctgagccggatctcgat
gacaatgaggaggaggaggagcctgctgtagaaattgaacctgagccagagccgcagccg
cagcctcagccacagccgcagccgcagcctgtggccccagccccaccacctgccaagaag
agaagagggcgacctcctggaagaaccaaccaacccaaacagaaccagccaacagccatc
atccaggttgaagaccagaatacaggtgcaattgagaacattatagttgaagtcaaaaaa
gagccagatgccgagcctgcggagggggaagaggaggaggctcaggcagcacccgcagac
gcccccaacggagacctcacgcctgagatgattctcagcatgatggaccggtga

DBGET integrated database retrieval system