KEGG   Rattus norvegicus (rat): 83791
Entry
83791             CDS       T01003                                 

Gene name
Fdps, Ac2-125, FPS
Definition
(RefSeq) farnesyl diphosphate synthase
  KO
K00787  farnesyl diphosphate synthase [EC:2.5.1.1 2.5.1.10]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00900  Terpenoid backbone biosynthesis
rno01100  Metabolic pathways
rno05164  Influenza A
rno05166  Human T-cell leukemia virus 1 infection
Module
rno_M00367  C10-C20 isoprenoid biosynthesis, non-plant eukaryotes
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    83791 (Fdps)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    83791 (Fdps)
   05164 Influenza A
    83791 (Fdps)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:rno01006]
    83791 (Fdps)
Enzymes [BR:rno01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.1  dimethylallyltranstransferase
     83791 (Fdps)
    2.5.1.10  (2E,6E)-farnesyl diphosphate synthase
     83791 (Fdps)
Prenyltransferases [BR:rno01006]
 Terpene biosynthesis
  Prenyl diphosphate synthase
   83791 (Fdps)
SSDB
Motif
Pfam: polyprenyl_synt
Other DBs
NCBI-GeneID: 83791
NCBI-ProteinID: NP_114028
RGD: 68953
Ensembl: ENSRNOG00000043377
UniProt: P05369 F1LND7
Position
2q34
AA seq 353 aa
MNGDQKLDVHNQEKQNFIQHFSQIVKVLTEDELGHPEKGDAITRIKEVLEYNTVGGKYNR
GLTVVQTFQELVEPRKQDAESLQRALTVGWCVELLQAFFLVLDDIMDSSHTRRGQICWYQ
KPGIGLDAINDALLLEAAIYRLLKFYCREQPYYLNLLELFLQSSYQTEIGQTLDLITAPQ
GQVDLGRYTEKRYKSIVKYKTAFYSFYLPIAAAMYMAGIDGEKEHANALKILLEMGEFFQ
IQDDYLDLFGDPSVTGKVGTDIQDNKCSWLVVQCLLRATPQQRQILEENYGQKDPEKVAR
VKALYEELDLRSVFFKYEEDSYNRLKSLIEQCSAPLPPSIFLELANKIYKRRK
NT seq 1062 nt   +upstreamnt  +downstreamnt
atgaatggggaccagaaactggatgttcataaccaagaaaagcagaatttcatccagcac
ttctcccagattgtcaaggtgctgactgaggatgaactgggacacccagagaagggagat
gctattacccggatcaaagaggtcctggagtacaacactgtaggaggcaagtacaatcgg
ggtctgacggtggtacagaccttccaggaactggtggaaccaaggaaacaggatgctgag
agcctacagcgggccctgacggtgggctggtgtgtagaactgctccaggctttcttcctc
gtgttagatgacatcatggactcttcccacactcgccgggggcagatctgctggtatcag
aagccgggcataggcttggatgccatcaacgatgctctgcttctggaagccgctatctac
cgcctgcttaagttctactgcagggagcagccctactacctcaacctgctggagctcttt
ctacagagttcctatcagactgagatcgggcagactctcgacctcatcacagcaccccag
ggccaagtggatcttggtagatacactgaaaagaggtacaaatctatcgtcaagtacaag
acagctttctactctttctacctgcctatcgcggctgccatgtacatggctggaattgat
ggggagaaggaacacgctaatgccctgaagatcctgctggagatgggcgagttcttccag
atccaggacgactaccttgatctctttggagaccccagtgtgaccggaaaggtcggcact
gacatccaggacaacaaatgcagctggctggtggttcagtgtctgctacgagccactcct
cagcagcgccagatcttagaggagaattatgggcagaaggacccagaaaaagtggcgcgg
gtgaaagcactgtacgaggagctggatctgcggagtgtgttcttcaagtacgaggaagac
agttacaaccgcctcaagagtctcatagagcagtgctccgcgcccctgcccccatccatc
ttcctggaactagcaaacaagatctacaagcggagaaagtaa

DBGET integrated database retrieval system