KEGG   Rattus norvegicus (rat): 83805Help
Entry
83805             CDS       T01003                                 

Gene name
Src
Definition
(RefSeq) SRC proto-oncogene, non-receptor tyrosine kinase
  KO
K05704  tyrosine-protein kinase Src [EC:2.7.10.2]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno01521  EGFR tyrosine kinase inhibitor resistance
rno01522  Endocrine resistance
rno04012  ErbB signaling pathway
rno04015  Rap1 signaling pathway
rno04062  Chemokine signaling pathway
rno04137  Mitophagy - animal
rno04144  Endocytosis
rno04360  Axon guidance
rno04370  VEGF signaling pathway
rno04510  Focal adhesion
rno04520  Adherens junction
rno04530  Tight junction
rno04540  Gap junction
rno04611  Platelet activation
rno04625  C-type lectin receptor signaling pathway
rno04727  GABAergic synapse
rno04750  Inflammatory mediator regulation of TRP channels
rno04810  Regulation of actin cytoskeleton
rno04912  GnRH signaling pathway
rno04915  Estrogen signaling pathway
rno04917  Prolactin signaling pathway
rno04919  Thyroid hormone signaling pathway
rno04921  Oxytocin signaling pathway
rno04926  Relaxin signaling pathway
rno05100  Bacterial invasion of epithelial cells
rno05152  Tuberculosis
rno05161  Hepatitis B
rno05163  Human cytomegalovirus infection
rno05167  Kaposi sarcoma-associated herpesvirus infection
rno05203  Viral carcinogenesis
rno05205  Proteoglycans in cancer
rno05219  Bladder cancer
rno05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    83805 (Src)
   04012 ErbB signaling pathway
    83805 (Src)
   04370 VEGF signaling pathway
    83805 (Src)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    83805 (Src)
   04137 Mitophagy - animal
    83805 (Src)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    83805 (Src)
   04520 Adherens junction
    83805 (Src)
   04530 Tight junction
    83805 (Src)
   04540 Gap junction
    83805 (Src)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    83805 (Src)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    83805 (Src)
   04625 C-type lectin receptor signaling pathway
    83805 (Src)
   04062 Chemokine signaling pathway
    83805 (Src)
  09152 Endocrine system
   04912 GnRH signaling pathway
    83805 (Src)
   04915 Estrogen signaling pathway
    83805 (Src)
   04917 Prolactin signaling pathway
    83805 (Src)
   04921 Oxytocin signaling pathway
    83805 (Src)
   04926 Relaxin signaling pathway
    83805 (Src)
   04919 Thyroid hormone signaling pathway
    83805 (Src)
  09156 Nervous system
   04727 GABAergic synapse
    83805 (Src)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    83805 (Src)
  09158 Development
   04360 Axon guidance
    83805 (Src)
 09160 Human Diseases
  09161 Cancers
   05205 Proteoglycans in cancer
    83805 (Src)
   05203 Viral carcinogenesis
    83805 (Src)
   05219 Bladder cancer
    83805 (Src)
  09165 Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    83805 (Src)
  09167 Infectious diseases
   05152 Tuberculosis
    83805 (Src)
   05100 Bacterial invasion of epithelial cells
    83805 (Src)
   05161 Hepatitis B
    83805 (Src)
   05163 Human cytomegalovirus infection
    83805 (Src)
   05167 Kaposi sarcoma-associated herpesvirus infection
    83805 (Src)
  09168 Drug resistance
   01521 EGFR tyrosine kinase inhibitor resistance
    83805 (Src)
   01522 Endocrine resistance
    83805 (Src)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    83805 (Src)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    83805 (Src)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     83805 (Src)
Protein kinases [BR:rno01001]
 Non-receptor tyrosine kinases
  SRC family
   83805 (Src)
Membrane trafficking [BR:rno04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    83805 (Src)
 Endocytosis
  Clathrin-mediated endocytosis
   Kinases
    83805 (Src)
  Lipid raft mediated endocytosis
   Caveolin-mediated endocytosis
    83805 (Src)
  Macropinocytosis
   Kinases
    83805 (Src)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase SH2 SH3_1 SH3_9 SH3_2 Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 83805
NCBI-ProteinID: NP_114183
RGD: 620795
Ensembl: ENSRNOG00000009495
UniProt: Q9WUD9
Position
3q42
AA seq 542 aa AA seqDB search
MGSNKSKPKDASQRRRSLEPAENVHGAGGAFPASQTPSKPASADGHRGPNAAFVPPAAAE
PKLFGGFNSSDTVTSPQRAGPLAGGVTTFVALYDYESRTETDLSFKKGERLQIVNNTRKV
DVREGDWWLAHSLSTGQTGYIPSNYVAPSDSIQAEEWYFGKITRRESERLLLNAENPRGT
FLVRESETTKGAYCLSVSDFDNAKGLNVKHYKIRKLDSGGFYITSRTQFNSLQQLVAYYS
KHADGLCHRLTTVCPTSKPQTQGLAKDAWEIPRESLRLEVKLGQGCFGEVWMGTWNGTTR
VAIKTLKPGTMSPEAFLQEAQVMKKLRHEKLVQLYAVVSEEPIYIVTEYMNKGSLLDFLK
GETGKYLRLPQLVDMSAQIASGMAYVERMNYVHRDLRAANILVGENLVCKVADFGLARLI
EDNEYTARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELTTKGRVPYPGMVNREV
LDQVERGYRMPCPPECPESLHDLMCQCWRKEPEERPTFEYLQAFLEDYFTSTEPQYQPGE
NL
NT seq 1629 nt NT seq  +upstreamnt  +downstreamnt
atgggcagcaacaagagcaagcccaaggacgccagccagaggcgccgcagcctggagccc
gcggagaacgtgcatggggcaggtggcgccttccctgcctcacagacaccaagcaagcct
gcctccgccgatggccaccgcgggcccaatgccgcctttgtgccccccgcggccgccgag
cccaagctcttcggaggcttcaactcctcggacactgtcacctccccacaaagggcgggg
cctctggcaggtggggtgactacctttgtggccctctatgactatgagtcacggacagag
actgacctgtccttcaagaaaggggagcggctgcagattgtcaataacacgaggaaggtg
gatgtcagagagggagactggtggctggcacactcgctgagcaccggacagaccggttac
atccccagtaactatgtggcgccctccgactccatccaggctgaggagtggtactttggc
aagatcactagacgggaatcagagcggctacttctcaacgccgagaaccccagagggacc
ttcctcgtgagggagagtgagaccacaaaaggtgcctactgcctctctgtatccgacttt
gacaatgccaagggcctaaatgtgaaacactacaagatccggaaactggacagtggcgga
ttctacatcacctcccgcacgcaattcaacagcctgcagcagcttgtggcttactactcc
aaacatgctgatggcctgtgtcaccgtctcactaccgtgtgtcccacatccaagcctcag
acccagggcctggccaaggatgcgtgggagatcccccgggagtccctgcggctggaggtc
aagctgggccagggttgcttcggagaggtgtggatggggacctggaacggcaccacgagg
gttgccatcaaaaccctgaagccaggcaccatgtctccagaggccttcctgcaggaggcc
caagtcatgaagaaactgaggcatgagaagctggtgcagctgtatgccgtggtgtcagaa
gaacccatttacattgtgacagagtacatgaacaaggggagtctgctggactttctcaag
ggggaaacgggcaaatacttgcggctaccccagctggtggacatgtctgctcagattgct
tcaggcatggcctatgtggagcggatgaactatgtgcaccgggacctccgagccgccaat
atcctggttggcgagaacctggtgtgcaaagtggccgactttgggctggcccggctcata
gaggacaacgaatacacagctcggcaaggtgccaaattccccatcaagtggaccgcccct
gaagcggctctgtatggcaggttcaccatcaagtcggacgtgtggtcctttggaatcctg
ctgactgagctcaccactaagggcagagtgccctatcctgggatggtgaaccgagaggtg
ctggaccaggtagagcggggctaccggatgccttgtccccccgagtgccctgagtccctg
catgacctcatgtgccagtgctggcggaaggagcctgaggagcggcccaccttcgagtac
ctgcaggccttcctggaggactactttacgtccacggagccgcagtaccagcccggggag
aacctatag

DBGET integrated database retrieval system