KEGG   Rattus norvegicus (rat): 84014
Entry
84014             CDS       T01003                                 

Gene name
Ralbp1
Definition
(RefSeq) ralA binding protein 1
  KO
K08773  RalA-binding protein 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04014  Ras signaling pathway
rno05200  Pathways in cancer
rno05212  Pancreatic cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    84014 (Ralbp1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    84014 (Ralbp1)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    84014 (Ralbp1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    84014 (Ralbp1)
Membrane trafficking [BR:rno04131]
 Others
  Rho GTPase associated proteins
   Rho GTPase-activating proteins
    84014 (Ralbp1)
SSDB
Motif
Pfam: RhoGAP Nod1
Other DBs
NCBI-GeneID: 84014
NCBI-ProteinID: NP_114456
RGD: 621134
Ensembl: ENSRNOG00000013461
Vega: OTTRNOG00000000944
UniProt: Q62796
Position
9q37
AA seq 693 aa
MTECFLPPTSSPSEHRRAEHGSGLTRTPSSEEISPTKFPGLYRTGEPSPPHDILHEPPDI
VSDDEKDHGKKKGKFKKKEKRTEGYAAFQEDSSGDEAESPSKMKRSKGIHVFKKPSFSKK
KEKDFKIKEKPKEEKHKEEKHKEEKHKEKKCKDLTAADVVKQWKEKKKKKKPTQEPEVPQ
TDAPSLRPIFGAPLADAVERTMMYDGIRLPAVFRECVDYMEKHGMKCEGIYRVSGIKSKV
DELKAAYDREESPNLEEYEPNTVASLLKQYLRDLPENLLTKELMPRFEEACGRTTEVEKV
QEFQRLLRELPEYNHLLLSWLIVHMDHVIAKELETKMNIQNISIVLSPTVQISNRVLYVL
FTHVQELFGTVVLKQVTRPLRWSNMATMPTLPETQAGIKEEIRRQEFLLNCLHRDLQGGI
KDLSKEERLWEVQRILTALKRKLREAKRQECETKIAQEIASLSKEDVSKEETNENEEVIN
ILLAQENEILTEQEELLAMEQFLRRQIASEKEEIDPLRAEIAEIQSRQHGRSETEEYSSD
SESESEDEEELQIILEDLQRQNEELEIKNNHLNQAVHEEREAIVELRVQLRLLQMLRAKS
EQQLQEEEEPERRGGTGPLPCEGVLEVRAAKEQAKPRPAKTGRRRPSELPRPCASYCKRE
SAACPARQRSVKALRDARSCTRLTPCQAQVLGE
NT seq 2082 nt   +upstreamnt  +downstreamnt
atgactgagtgcttcctgccccccaccagcagccctagtgaacaccgcagggccgagcac
ggcagcgggctgacccggacccccagctccgaggagatcagccctacaaaatttcctgga
ttgtaccggacgggtgagccttcacctccccatgacatcctccacgagcctcctgatatc
gtgtcagatgatgagaaagaccatggaaagaaaaaaggaaaatttaagaaaaaggagaaa
aggactgaaggctacgctgccttccaggaagacagctctggagatgaggctgaaagtcct
tccaagatgaagaggtccaagggcatccatgtgttcaaaaagcccagcttctctaaaaag
aaggaaaaggattttaaaatcaaagaaaagcccaaagaagaaaagcacaaagaagaaaag
cataaagaggaaaagcataaagaaaagaaatgtaaagacttgacggccgccgatgttgtt
aaacagtggaaggaaaagaagaaaaagaagaagccaactcaggagccagaggtgcctcag
acggacgccccgagtctcagacccattttcggcgctcccttggctgacgcagtagagagg
accatgatgtacgacggcatccggctgccagctgtcttccgggagtgcgtggactacatg
gagaagcacggcatgaaatgtgaaggcatctaccgagtgtcaggaatcaaatcaaaggta
gatgagctgaaagcagcctatgaccgagaggagtctccaaacttggaagaatatgaacct
aacactgtagccagcttgctgaagcagtatctgcgagaccttcccgagaatttgcttacc
aaagagcttatgccccgatttgaagaggcttgtgggaggaccacagaggtggagaaagtg
caggagttccagcgcttgctcagggaactgccggagtacaaccatcttctgctctcctgg
ctcattgtgcacatggaccacgtcatcgcgaaggagctggaaaccaagatgaacatccag
aacatctccatagtgctgagcccaaccgtccagatcagcaaccgggtcctgtatgtgctt
ttcacacacgtgcaagagctctttggcaccgtggtcctgaagcaagtaacgagacctctg
cgttggtccaacatggccacaatgcctacactgccagagacccaagcaggcatcaaggaa
gaaatcaggagacaggagttccttttgaactgtttacatcgagatctgcagggcgggata
aaggacttgtctaaagaagaaagattatgggaagtacagaggattctgactgccctcaag
agaaagctgagggaagctaaaagacaagagtgtgagaccaagattgcacaggagatagcc
agcctttcgaaggaggatgtttccaaagaagaaacgaacgaaaacgaggaggtcataaat
atcctccttgcccaggagaatgagatcctgactgagcaggaggagctcctggccatggag
cagtttctgcgtcgtcagatcgcctcggagaaagaagagattgaccccctccgagctgag
attgcggagatccagagtcgccagcatggccgcagcgagacagaggagtactcctctgac
agcgagagcgagagcgaggatgaggaggagctgcagatcattctggaagacttacagagg
cagaatgaagagttagaaataaagaacaatcacttgaaccaggcagtccatgaagagcgg
gaggccatcgttgagctccgagtgcagctccggctgctccagatgctgcgagccaagtct
gagcagcagctccaggaggaggaggagcccgagaggcgagggggcacaggcccactaccc
tgtgaaggtgtcctcgaggtgagagcagccaaggagcaggcgaagcctcgcccagcaaag
accggaaggagacgcccatctgaactgccccggccctgtgcatcgtactgtaagcgagag
tccgctgcctgtcctgccaggcagcgttctgtgaaggctctcagagacgctcgctcttgc
acacgtctgactccgtgtcaggctcaggtcctgggagagtga

DBGET integrated database retrieval system