KEGG   Rattus norvegicus (rat): 84032
Entry
84032             CDS       T01003                                 

Symbol
Col3a1
Name
(RefSeq) collagen alpha-1(III) chain precursor
  KO
K19720  collagen type III alpha
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04611  Platelet activation
rno04926  Relaxin signaling pathway
rno04933  AGE-RAGE signaling pathway in diabetic complications
rno04974  Protein digestion and absorption
rno05146  Amoebiasis
rno05415  Diabetic cardiomyopathy
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    84032 (Col3a1)
  09152 Endocrine system
   04926 Relaxin signaling pathway
    84032 (Col3a1)
  09154 Digestive system
   04974 Protein digestion and absorption
    84032 (Col3a1)
 09160 Human Diseases
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    84032 (Col3a1)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    84032 (Col3a1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    84032 (Col3a1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:rno00536]
    84032 (Col3a1)
Glycosaminoglycan binding proteins [BR:rno00536]
 Heparan sulfate / Heparin
  Extracellular matrix molecules
   84032 (Col3a1)
SSDB
Motif
Pfam: Collagen COLFI VWC TILa
Other DBs
NCBI-GeneID: 84032
NCBI-ProteinID: NP_114474
RGD: 71029
Ensembl: ENSRNOG00000003357
UniProt: P13941
Position
9
AA seq 1463 aa
MMSFVQCGTWFLLTLLHPSLILAQQSNVDELGCNYLGQSYESRDVWKPEPCQICVCDSGS
VLCDDIMCDDEPLDCPNPEIPFGECCAICPQPSTPAPVIPDGNRPQGPKGDPGPPGIPGR
NGDPGLPGQPGLPGPPGSPGICESCPTGGQNYSPQFDSYDVKSGVGGMGGYPGPAGPPGP
PGPPGSSGHPGSPGSPGYQGPPGEPGQAGPAGPPGPPGAIGPSGPAGKDGESGRPGRPGE
RGLPGPPGIKGPAGIPGFPGMKGHRGFDGRNGEKGETGAPGLKGENGLPGDNGAPGPMGP
RGAPGERGRPGLPGAAGARGNDGARGSDGQPGPPGPPGTAGFPGSPGAKGEVGPAGSPGS
NGSPGQRGEPGPQGHAGAQGPPGPPGNNGSPGGKGEMGPAGIPGAPGLLGARGPPGPAGA
NGAPGQRGPSGEPGKNGAKGEPGARGERGEAGSPGIPGPKGEDGKDGSPGEPGANGVPGN
PGERGAPGFRGPAGPNGAPGEKGPAGERGGPGPAGPRGVAGEPGRDGTPGGPGIRGMPGS
PGGPGNDGKPGPPGSQGESGRPGPPGPSGPRGQPGVMGFPGPKGNDGAPGKNGERGGPGG
PGLPGPAGKNGETGPQGPPGPTGAPGDKGDAGPPGPQGLQGIPGTSGPPGENGKPGEPGP
KGEAGAPGVPGGKGDSGAPGERGPPGTAGTPGLRGGAGPPGPEGGKGPAGPPGPPGTSGP
PGLQGMPGERGGPGSPGPKGEKGEPGGAGADGVPGKDGPRGPAGPIGPPGPAGQPGDKGE
GGAPGLPGIAGPRGGPGERGEHGPPGPAGFPGAPGQNGEPGAKGERGAPGEKGEGGPPGA
AGPPGGSGPAGPPGPQGVKGERGSPGGPGAAGFPGGRGLPGPPGNNGNPGPPGPSGAPGK
DGPPGPAGNSGSPGNPGVAGPKGDAGQPGEKGPPGAQGPPGSPGPLGIAGLTGARGLAGP
PGMPGPRGSPGPQGIKGESGKPGASGHNGERGPPGPQGLPGQPGTAGEPGRDGNPGSDGQ
PGRDGSPGGKGDRGENGSPGAPGAPGHPGPPGPVGPSGKNGDRGETGPAGPSGAPGPAGA
RGAPGPQGPRGDKGETGERGSNGIKGHRGFPGNPGPPGSPGAAGHQGAVGSPGPAGPRGP
VGPHGPPGKDGSSGHPGPIGPPGPRGNRGERGSEGSPGHPGQPGPPGPPGAPGPCCGGGA
AIAGVGGEKSGGFSPYYGDDPMDFKINTEEIMSSLKSVNGQIESLISPDGSRKNPARNCR
DLKFCHPELKSGEYWVDPNQGCKMDAIKVFCNMETGETCINASPMTVPRKHWWTDAGAEK
KHVWFGESMNGGFQFSYGNPDLPEDVLDVQLAFLRLLSSRASQNITYHCKNSIAYMDQAN
GNVKKSLKLMGSNEGEFKAEGNSKFTYTVLEDGCTKHTGEWSKTVFEYQTRKAMRLPIID
IAPYDIGGPDQEFGVDIGPVCFL
NT seq 4392 nt   +upstreamnt  +downstreamnt
atgatgagctttgtgcaatgtgggacctggtttcttctcaccctgcttcacccctctctt
attttggcacagcagtccaatgtagatgaattgggatgcaactaccttggtcagtcctat
gagtctagagatgtctggaagccagaaccatgtcaaatatgtgtctgcgactcgggatct
gtcctctgtgatgacataatgtgtgatgatgagccactagactgccccaacccagagatc
ccatttggagaatgttgtgcaatatgtccacagccttctacacctgctcctgtcattcct
gatggtaatagacctcaaggccccaagggagatccaggccctcctggcattcctgggaga
aatggcgaccctggtcttccaggacaaccagggctccctggtcctcctggctcccctgga
atctgtgaatcatgtccaactggtggccagaattattctccccaattcgactcatatgat
gtcaagtctggagtcggaggaatgggtggctatcctggaccagctggtccaccaggccct
ccaggaccccctggttcctctggacatcctggatctcctggttctcctggataccaaggt
cctcctggtgaaccgggtcaagctggtcctgcaggccctccaggacctcctggtgctatt
ggtccatctggccctgcaggaaaggatggagagtcaggaagacccggacgacctggagag
cgtggactgcctggacctccaggtatcaaaggcccagctggtatccctggattcccgggt
atgaaaggacacagaggctttgatggacgcaatggagagaagggtgaaaccggtgctcct
ggattgaagggtgaaaacggtcttccgggagacaacggagctcctggccccatgggtccc
agaggggctcctggtgagcgaggacgaccaggtcttcctggagccgcaggtgctcgaggc
aatgatggtgctcggggcagtgacgggcaaccaggtccccctggtcctcctggaactgca
ggattccctggatctcctggtgctaagggtgaggttggacctgcaggatcccctggctca
aatggctctccaggacaaagaggggaacctggaccacaaggacacgctggtgctcaagga
cctcctggccctcctggcaataatggcagtcctggtgggaaaggtgaaatgggtccagct
ggcattcctggagctcctggactcctaggagctaggggtccccctggaccagcaggagct
aatggtgcaccgggacaacgaggtccttcaggcgaaccgggcaagaatggagcaaaggga
gagccaggagctcgcggtgaacggggcgaagctggttccccagggattccaggacctaag
ggcgaagacggcaaagatgggtcaccaggagaacctggtgcaaatggagttccaggaaac
ccaggagaaaggggtgcccctggcttccgaggacctgcagggccaaatggcgccccagga
gaaaagggtcctgctggagagcgtggtggcccaggtcctgcaggacctagaggagtagct
ggagaacctggccgagatggaacccctggaggtccagggatacggggtatgcccggaagt
ccaggtggaccaggcaatgatgggaaaccaggacctcctggaagtcaaggagaaagtggt
cgccctggtcctcctggcccatctggccccagaggtcagcctggtgtcatgggtttccct
ggtcctaaaggaaatgatggtgcacctggcaaaaacggagaacggggtggccctgggggt
cctggccttccaggtcctgctggaaagaatggggagactggacctcagggtcccccagga
cctactggcgcacctggtgacaagggagacgctggaccccctggtccacaaggattacaa
ggcatacctggtaccagtggtcctccaggagaaaatggaaaaccaggagaaccaggtcca
aagggtgaagctggagcacctggagttcctggaggcaagggtgattctggtgcccctgga
gaacgtggaccccctggaaccgcaggaacccctgggcttagaggtggagctggaccccct
gggcctgagggaggaaagggccctgctggtccccctggtccccctggtacttctggtcct
cctggtctgcaagggatgccaggagagagaggaggtcctgggagtcctggcccaaagggt
gaaaagggtgagccaggcggtgcgggtgctgatggagttccaggaaaggatgggccgaga
ggtcctgctggtcctattggtccccctggcccagctggtcagcctggagataagggtgaa
ggtggtgcccctggacttccaggtatagctggacctcgaggtggccctggtgagagaggt
gaacatggccctccaggacctgctggcttcccgggtgctcctgggcagaatggtgaacca
ggtgctaaaggagaaagaggtgcccccggagagaaaggtgaaggaggccctcctggtgcc
gcaggaccccctggtggttctggacctgctggtcctcctgggcctcaaggtgtaaagggt
gaacggggcagtcctggcggtcctggtgctgctggctttcccggtggccgtggtcttcct
ggtcctcccggcaacaatggtaatccagggcccccaggacccagtggtgctcctggcaag
gatggccctccaggtcctgcaggtaacagtggttctcctggaaaccctggagtagctgga
ccaaaaggtgatgctggccaaccaggagagaaggggccacctggtgctcagggtcctcca
ggatctccaggtccacttggaattgcagggctaactggagcacgaggtcttgctggacca
ccaggcatgccaggtccacggggtagccctggacctcagggtatcaagggtgaaagtgga
aagccaggagccagtggccataatggggaacgtggtcctcctggaccccaaggtcttcct
ggtcagcctggtacagctggtgagcccggaagggatggaaaccctggatcagatggtcag
ccaggtcgagacggatctcctggtggcaagggtgatcgtggtgaaaatggttctcctggt
gccccaggcgctcctggtcatccaggaccacctggtcctgttggtccatctggaaaaaat
ggtgacagaggagaaacgggtcctgctggtccttctggtgctccaggtcctgctggagct
cggggtgctcctggtccccaaggtccacgaggtgacaaaggtgaaactggtgaacgtggc
tctaatggcatcaaaggacatcgaggattccctggcaatccaggtcccccaggttctccc
ggtgctgctggacaccagggtgcagttggtagtccaggccctgcaggtcccagaggccca
gttggtccacatggacctcctggaaaagatggatcaagtggacatccaggtcccattgga
ccaccagggcctcgaggtaacagaggtgaaagaggatctgagggctcgcccggtcaccct
ggacagccaggaccccctggaccccctggtgcccctggtccctgctgtggtggcggtgct
gccattgctggagttggaggtgaaaagtctggcggcttttcaccatattacggggatgat
ccaatggatttcaagatcaacactgaggagatcatgtcttcactcaagtctgttaacgga
caaatagagagtcttatcagccctgatggttctagaaaaaaccctgctcggaattgcaga
gacctgaaattctgccaccctgaactcaagagcggagaatactgggttgatcctaaccaa
ggctgcaagatggatgctataaaagtgttctgtaatatggaaaccggagaaacatgcata
aatgccagtcccatgactgtcccgcggaagcactggtggacagatgctggtgctgagaag
aaacatgtttggtttggagaatctatgaatggtggctttcagttcagctatggcaatcct
gatcttcctgaagatgtccttgatgtacagctggccttcctcagacttctttccagccgg
gcctcccagaacattacataccactgcaaaaacagcattgcctacatggatcaggccaat
ggcaatgtaaagaagtctctgaagctgatgggatccaatgagggagaattcaaggctgaa
ggaaatagcaaattcacttacacagttctagaggatggctgcactaaacacactggtgaa
tggagcaagacagtctttgaatatcaaacacgcaaggccatgagactccccatcatagat
atcgcaccctatgacattggtggtcctgatcaagaatttggtgtggacattggccctgtt
tgctttttataa

DBGET integrated database retrieval system