KEGG   Rattus norvegicus (rat): 84392
Entry
84392             CDS       T01003                                 

Gene name
Kif3a
Definition
(RefSeq) kinesin family member 3a
  KO
K10394  kinesin family member 3A
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    84392 (Kif3a)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:rno04812]
    84392 (Kif3a)
Cytoskeleton proteins [BR:rno04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Kinesins
     84392 (Kif3a)
SSDB
Motif
Pfam: Kinesin Microtub_bd
Other DBs
NCBI-GeneID: 84392
NCBI-ProteinID: NP_445829
RGD: 621536
Ensembl: ENSRNOG00000007515
UniProt: F1LQZ3 Q9WV62
Position
10q22
AA seq 702 aa
MPINKSEKPESCDNVKVVVRCRPLNEREKSMCYRQAVSVDEMRGTITVHKTDSSNEPPKT
FTFDTVFGPESKQLDVYNLTARPIIDSVLEGYNGTIFAYGQTGTGKTFTMEGVRAVPGLR
GVIPNSFAHIFGHIAKAEGDTRFLVRVSYLEIYNEEVRDLLGKDQTQRLEVKERPDVGVY
IKDLSAYVVNNADDMDRIMTLGHKNRSVGATNMNEHSSRSHAIFTITIECSEKGVDGNMH
VRMGKLHLVDLAGSERQAKTGATGQRLKEATKINLSLSTLGNVISALVDGKSTHVPYRNS
KLTRLLQDSLGGNSKTMMCANIGPADYNYDETISTLRYANRAKNIKNKARINEDPKDALL
RQFQKEIEELKKKLEEGEEVSGSDISGSEEDDNEEGELGEDGEKRKKRRDQAGKKKVSPD
KMMEMQAKIDEERKALETKLDMEEEERNKARAELERREKDLLKAQQEHQSLLEKLSALEK
KVIVGGVDLLAKAEEQEKLLEESNMELEERRKRAEQLRKELEEKEQERLDIEEKYTSLQE
EAQGKTKKLKKVWTMLMAAKSEMADLQQEHQREIEGLLENIRQLSRELRLQMLIIDNFIP
QDYQEMIENYVHWNEDIGEWQLKCVAYTGNNMRKQTPVPDKKERDPFEVDLSHVYLAYTE
ESLRQSLMKLERPRTSKGKARPKTGRRKRSAKPETVIDSLLQ
NT seq 2109 nt   +upstreamnt  +downstreamnt
atgccgatcaataaatcagagaagccagaaagctgcgacaacgtgaaggtagttgtcagg
tgccgacctctcaacgagagagagaaatcaatgtgctacagacaggccgtcagcgtggat
gaaatgcgggggactatcaccgtccataagaccgactcttccaacgaacctccgaagaca
tttactttcgatactgtttttggaccagagagtaaacaacttgatgtatataacttgact
gcaagaccaattattgattctgtcctggaaggctacaatgggaccatttttgcatatgga
cagactgggacaggcaagactttcaccatggaaggtgttcgagcagtgccggggctcaga
ggggtcatccccaactcatttgctcacatatttggtcatatcgcaaaagcagagggcgac
acaaggtttctggttcgagtgtcatacttagagatatataatgaagaagtccgagacctt
ctgggtaaagatcagacacagaggttggaggttaaagaaaggcctgacgtgggagtatat
atcaaagatttatcagcatatgtagtcaacaatgctgacgacatggatagaatcatgact
ctgggccacaaaaaccgttccgttggtgcgaccaatatgaacgagcacagttcccgatcg
cacgccatcttcacaattacaatcgagtgcagcgagaaaggcgtggatggaaacatgcac
gtcaggatggggaagctccaccttgtggatcttgctgggtcagaaagacaagcaaaaact
ggagccacagggcagcgcctcaaagaagctaccaaaatcaacctttcattgtctaccttg
ggcaatgtcatttctgccttggtggatggaaaaagcactcatgtgccgtatcggaactct
aaactgacacgtctcctgcaggattccttaggagggaactcaaaaaccatgatgtgtgca
aatattgggccagcagattataattatgatgaaaccatcagtaccttgcggtatgccaac
cgcgccaagaacattaaaaacaaagctagaattaacgaagacccaaaggacgctctgctt
cgccagtttcagaaagaaatagaagagctgaagaaaaagcttgaggaaggggaagaagtg
tcaggctctgacatcagtgggtcagaggaggatgacaacgaggagggtgaacttggagaa
gatggagaaaaaaggaaaaagagaagggaccaagcaggtaaaaagaaagtttccccagat
aagatgatggaaatgcaagcgaaaattgatgaggagagaaaagcactggaaaccaaactc
gacatggaggaagaagaaagaaacaaggctagagctgagctggagcgacgggagaaggac
cttctgaaagcccaacaagagcatcagtctttgctggaaaaactgtctgcgctggagaag
aaggtgattgtcggtggtgtggacttgttggccaaagctgaggagcaagagaagcttctc
gaggagtccaatatggagctggaggagcggaggaaaagagctgagcaacttcggaaagaa
ctagaggaaaaagagcaagaacgcttggacatcgaggaaaaatataccagtctgcaagag
gaggcacaaggaaagaccaagaaattaaagaaagtctggaccatgctgatggctgcaaag
tcagagatggctgatctccagcaagagcatcagagggaaattgaaggcctcctggagaac
attcggcagctcagccgtgagctccgacttcagatgctcatcattgataacttcatacct
caggactaccaggaaatgattgaaaactacgtccactggaatgaagacataggagaatgg
cagctgaaatgtgtggcctacacaggaaataacatgaggaaacaaactccagtccctgac
aagaaggagagagacccatttgaagtagacctttcccacgtgtacctcgcctatacagag
gagagtttgcgtcagtctctgatgaagttagaaaggccacggacctccaagggaaaggcc
aggccaaagaccggtagaagaaagcgttctgcaaagcctgagaccgtaattgattcttta
cttcagtaa

DBGET integrated database retrieval system