KEGG   Rattus norvegicus (rat): 84392
Entry
84392             CDS       T01003                                 

Gene name
Kif3a
Definition
(RefSeq) kinesin-like protein KIF3A
  KO
K10394  kinesin family member 3A
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    84392 (Kif3a)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:rno04812]
    84392 (Kif3a)
Cytoskeleton proteins [BR:rno04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Kinesins
     84392 (Kif3a)
Motif
Pfam: Kinesin Microtub_bd PIF1
Other DBs
NCBI-GeneID: 84392
NCBI-ProteinID: NP_445829
RGD: 621536
Ensembl: ENSRNOG00000007515
UniProt: F1LQZ3 Q9WV62
Position
10
AA seq 702 aa
MPINKSEKPESCDNVKVVVRCRPLNEREKSMCYRQAVSVDEMRGTITVHKTDSSNEPPKT
FTFDTVFGPESKQLDVYNLTARPIIDSVLEGYNGTIFAYGQTGTGKTFTMEGVRAVPGLR
GVIPNSFAHIFGHIAKAEGDTRFLVRVSYLEIYNEEVRDLLGKDQTQRLEVKERPDVGVY
IKDLSAYVVNNADDMDRIMTLGHKNRSVGATNMNEHSSRSHAIFTITIECSEKGVDGNMH
VRMGKLHLVDLAGSERQAKTGATGQRLKEATKINLSLSTLGNVISALVDGKSTHVPYRNS
KLTRLLQDSLGGNSKTMMCANIGPADYNYDETISTLRYANRAKNIKNKARINEDPKDALL
RQFQKEIEELKKKLEEGEEVSGSDISGSEEDDNEEGELGEDGEKRKKRRDQAGKKKVSPD
KMMEMQAKIDEERKALETKLDMEEEERNKARAELERREKDLLKAQQEHQSLLEKLSALEK
KVIVGGVDLLAKAEEQEKLLEESNMELEERRKRAEQLRKELEEKEQERLDIEEKYTSLQE
EAQGKTKKLKKVWTMLMAAKSEMADLQQEHQREIEGLLENIRQLSRELRLQMLIIDNFIP
QDYQEMIENYVHWNEDIGEWQLKCVAYTGNNMRKQTPVPDKKERDPFEVDLSHVYLAYTE
ESLRQSLMKLERPRTSKGKARPKTGRRKRSAKPETVIDSLLQ
NT seq 2109 nt   +upstreamnt  +downstreamnt
atgccgatcaataaatcagagaagccagaaagctgcgacaacgtgaaggtagttgtcagg
tgccgacctctcaacgagagagagaaatcaatgtgctacagacaggccgtcagcgtggat
gaaatgcgggggactatcaccgtccataagaccgactcttccaacgaacctccgaagaca
tttactttcgatactgtttttggaccagagagtaaacaacttgatgtatataacttgact
gcaagaccaattattgattctgtcctggaaggctacaatgggaccatttttgcatatgga
cagactgggacaggcaagactttcaccatggaaggtgttcgagcagtgccggggctcaga
ggggtcatccccaactcatttgctcacatatttggtcatatcgcaaaagcagagggcgac
acaaggtttctggttcgagtgtcatacttagagatatataatgaagaagtccgagacctt
ctgggtaaagatcagacacagaggttggaggttaaagaaaggcctgacgtgggagtatat
atcaaagatttatcagcatatgtagtcaacaatgctgacgacatggatagaatcatgact
ctgggccacaaaaaccgttccgttggtgcgaccaatatgaacgagcacagttcccgatcg
cacgccatcttcacaattacaatcgagtgcagcgagaaaggcgtggatggaaacatgcac
gtcaggatggggaagctccaccttgtggatcttgctgggtcagaaagacaagcaaaaact
ggagccacagggcagcgcctcaaagaagctaccaaaatcaacctttcattgtctaccttg
ggcaatgtcatttctgccttggtggatggaaaaagcactcatgtgccgtatcggaactct
aaactgacacgtctcctgcaggattccttaggagggaactcaaaaaccatgatgtgtgca
aatattgggccagcagattataattatgatgaaaccatcagtaccttgcggtatgccaac
cgcgccaagaacattaaaaacaaagctagaattaacgaagacccaaaggacgctctgctt
cgccagtttcagaaagaaatagaagagctgaagaaaaagcttgaggaaggggaagaagtg
tcaggctctgacatcagtgggtcagaggaggatgacaacgaggagggtgaacttggagaa
gatggagaaaaaaggaaaaagagaagggaccaagcaggtaaaaagaaagtttccccagat
aagatgatggaaatgcaagcgaaaattgatgaggagagaaaagcactggaaaccaaactc
gacatggaggaagaagaaagaaacaaggctagagctgagctggagcgacgggagaaggac
cttctgaaagcccaacaagagcatcagtctttgctggaaaaactgtctgcgctggagaag
aaggtgattgtcggtggtgtggacttgttggccaaagctgaggagcaagagaagcttctc
gaggagtccaatatggagctggaggagcggaggaaaagagctgagcaacttcggaaagaa
ctagaggaaaaagagcaagaacgcttggacatcgaggaaaaatataccagtctgcaagag
gaggcacaaggaaagaccaagaaattaaagaaagtctggaccatgctgatggctgcaaag
tcagagatggctgatctccagcaagagcatcagagggaaattgaaggcctcctggagaac
attcggcagctcagccgtgagctccgacttcagatgctcatcattgataacttcatacct
caggactaccaggaaatgattgaaaactacgtccactggaatgaagacataggagaatgg
cagctgaaatgtgtggcctacacaggaaataacatgaggaaacaaactccagtccctgac
aagaaggagagagacccatttgaagtagacctttcccacgtgtacctcgcctatacagag
gagagtttgcgtcagtctctgatgaagttagaaaggccacggacctccaagggaaaggcc
aggccaaagaccggtagaagaaagcgttctgcaaagcctgagaccgtaattgattcttta
cttcagtaa

DBGET integrated database retrieval system