KEGG   Rattus norvegicus (rat): 84410Help
Entry
84410             CDS       T01003                                 

Gene name
Klf5, Bteb2, IKLF
Definition
(RefSeq) Kruppel-like factor 5
  KO
K09206  krueppel-like factor 5
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    84410 (Klf5)
Transcription factors [BR:rno03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 developmental/cell cycle regulators, Krueppel-like
    84410 (Klf5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-C2H2 zf-H2C2_2 zf-C2H2_4 zf-met zf-C2H2_jaz zf-C2H2_2
Motif
Other DBs
NCBI-GeneID: 84410
NCBI-ProteinID: NP_445846
RGD: 621446
Ensembl: ENSRNOG00000008785
UniProt: Q66HP1
Position
15q21
AA seq 443 aa AA seqDB search
MPTRVLTMSARLGPVPQPPAAQDEPVFAQLKPVLGAANPVRDAALFPGDDLKHAHHHPPA
PPPAAGPRLPCEELVQTRCEMEKYLTPQLPPVPIISEHKKYRRDSASVVDQFFTDTEGLP
YSINMNVFLPDITHLRTGLYKSQRPCVTQIKTEPVTIFSHQSESTAPPPPAPTQALPEFT
SIFSSHQTTAPEVNNIFIKQELPIPDLHLSVPSQQGHLYQLLNTPDLDMPSSTNQTAVMD
TLNVSMAGLNSHPSAVPQTSMKQFQGMPPCTYTMPSQFLPQQATYFPPSPPSSEPGSPDR
QAEMLQNLTPPPSYAATIASKLAIHNPNLPATLPVNSPNIQPVRYNRRSNPDLEKRRIHF
CDYDGCTKVYTKSSHLKAHLRTHTGEKPYKCTWEGCDWRFARSDELTRHYRKHTGAKPFQ
CVVCNRSFSRSDHLALHMKRHQN
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
atgcccacgcgggtgctgaccatgagcgcccgcctgggaccagtgccccagccgccggcc
gcgcaggacgagccagtgttcgcgcagctcaagccggtgctgggcgctgcgaacccggtc
cgcgacgcggcgctcttccccggagacgatctgaaacacgcgcaccaccacccgcctgcg
ccgccgccagccgccggcccgcgactgccttgcgaggagctggtccagacaagatgtgaa
atggagaagtatctgacacctcagcttcctccagttccgataatttcagagcataaaaaa
tacagacgagacagtgcctcagtggtcgaccagttcttcactgacactgaaggcttacct
tacagcatcaacatgaacgtcttcctccctgacatcacgcacctgagaactggcctctac
aaatcccagagaccatgcgtaacacagatcaagacagaacctgttaccattttcagccac
cagagcgaatccaccgcccctcctcctccggcccccacccaggccctccctgagttcacc
agtatattcagctcccaccagaccacagcgccagaggtgaacaatatcttcatcaaacaa
gaacttcctataccagatcttcatctctcggtcccttcccagcagggccacctgtaccag
ctgttgaatacacctgatctagacatgcccagttcgacaaaccagacagcagtcatggac
acccttaatgtctctatggctggccttaactcacacccctctgctgtgccacagacgtcc
atgaaacagttccagggcatgcctccttgcacgtacaccatgccgagtcagtttcttcca
cagcaggccacctactttcccccatcaccaccgagctcagagcctggaagtcctgataga
caagctgagatgctccagaatctgaccccacctccgtcctatgctgctacaattgcttcg
aaactggcaattcacaatccaaatttacctgccactctgccagttaattcgccaaatatc
caacctgtccgatacaacagaaggagtaacccggatctggagaagcgacgcatccatttc
tgtgattatgatggttgcacaaaagtttatacaaagtcgtctcatttaaaagctcacctg
aggactcatacgggcgagaagccctacaagtgcacctgggagggctgcgactggaggttt
gcccggtcggacgagctgacccgccactacaggaagcacacgggtgccaagccgttccag
tgcgtggtgtgcaaccgcagcttctcccgctccgaccacctggcgctgcacatgaagcgc
caccagaactga

DBGET integrated database retrieval system