KEGG   Rattus norvegicus (rat): 84600Help
Entry
84600             CDS       T01003                                 

Gene name
Rag1
Definition
(RefSeq) recombination activating 1
  KO
K10628  V(D)J recombination-activating protein 1 [EC:2.3.2.27]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04068  FoxO signaling pathway
rno05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    84600 (Rag1)
 09160 Human Diseases
  09163 Immune disease
   05340 Primary immunodeficiency
    84600 (Rag1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:rno04121]
    84600 (Rag1)
Enzymes [BR:rno01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     84600 (Rag1)
Ubiquitin system [BR:rno04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    84600 (Rag1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RAG1 RAG1_imp_bd zf-RAG1 zf-C3HC4 zf-C3HC4_2 zf-RING_6 zf-RING_2
Motif
Other DBs
NCBI-GeneID: 84600
NCBI-ProteinID: NP_445920
RGD: 619790
Ensembl: ENSRNOG00000004630
UniProt: G3V6K9
Position
3q31
AA seq 1040 aa AA seqDB search
MAVPLPSTLRLSSAPDEIQHPHIKFSEWKFKLFRVRSFEKAPEEAQKEKDSSEGKPCLEQ
SPVVLDKPGGQNSVLTQRALKLHPKFSKKFHVDGKSSDKAIHQARLRHFCRICGNHFKSD
GHNRRYPVHGPVDAKTQSLFRKKEKRVTSWPDLIARVFRIDVKSDVDSIHPTEFCHNCWS
IMHRKFGSAHSQVYCPRNVTVEWHPHTPSCDICFTAHRGLKRKRHQPNVQLSKKLKTVLN
HARRDRRKRTQARVSSKEVMKKISNCSKIHLSTKLLAVDFPAHFVKSISCQICEHILADP
VETTCKHLFCRICILRCLKVMGSYCPSCRYPCFPTDLQSPVKSFLSILNSLMVKCPAQEC
NEEVSLEKYNHHVSSHKESKETLVHINKGGRPRQHLLSLTRRAQKHRLRELKIQVKEFAD
KEEGGDVKSVCLTLFLLALRARNEHRQADELEAIMQGRGSGLQPAVCLAIRVNTFLSCSQ
YHKMYRTVKAITGRQIFQPLHALRNAEKVLLPGYHPFEWQPPLKNVSSRTDVGIIDGLSG
LASSVDEYPVDTIAKRFRYDSALVSALMDMEEDILDGMRSQDLDDYVSGPFTVVVKESCD
GMGDVSEKHGSGPAVPEKAVRFSFTVMRVTVEHGSQNVKIFEEPKPNSELCCKPLCLMLA
DESDHETLTAILSPLIAEREAMKSSELLLEMGGIPRTFKFIFRGTGYDEKLVREVEGLEA
SGSVYICTLCDATRLEASQNLVFHSITRSHAENLQRYEVWRSNPYHESVEELRDRVKGVS
AKPFIETVPSIDALHCDIGNAAEFYKIFQLEIGEVYKNPNASKEERKRWQATLDKHLRKR
MNLKPIMRMNGNFARKLMTQETVDAVCELIPSEERHEALRELMDLYLKMKPVWRSSCPAK
ECPESLCQYSFNSQRFAELLSTKFKYRYEGKITNYFHKTLAHVPEIIERDGSIGAWASEG
NESGNKLFRRFRKMNARQSKCYEMEDVLKHHWLYTSKYLQKFMNAHNALKNSGFTMNSKE
TLGDSLDIEDSLESQDSMEF
NT seq 3123 nt NT seq  +upstreamnt  +downstreamnt
atggctgtccccttgccatctaccctgagactcagttctgcacctgatgaaattcagcac
ccgcacatcaaattttccgagtggaaatttaagctgtttagggtgagatcctttgaaaag
gcacccgaagaagcacaaaaagagaaggattcctcagaagggaaaccttgtctcgagcag
tctccagtagttctagataagcctgggggtcagaattcagttctgactcaacgagcattg
aaactccatcctaaattttcaaagaaattccatgttgatgggaagtcaagcgacaaagca
attcaccaagccaggcttagacacttctgccgcatctgtggcaatcacttcaagagtgac
gggcacaaccggagatacccagtccacgggcccgtggacgctaaaactcaaagccttttc
cgaaagaaggaaaaaagagtcacgtcctggccagatctcattgccagagttttccggatt
gatgtgaagtcagatgttgactccatccaccccactgaattctgccataactgttggagc
attatgcacaggaagttcggcagtgctcacagtcaggtctactgcccaaggaatgtgacc
gtggagtggcacccccacacaccgtcctgtgacatctgctttactgcccatcggggactg
aagaggaagagacatcagcccaacgtgcagctcagcaagaaactaaaaactgtgctcaac
catgctagacgggaccgtcgcaagagaactcaggctagggtcagcagcaaggaggtcatg
aagaagatctccaactgcagtaagattcatctcagtaccaagcttcttgcagtagacttc
ccagcacactttgtgaaatccatctcctgccagatatgtgaacacattctggccgatccg
gtggagaccacctgtaagcacctgttctgtagaatatgcattctccggtgcctcaaggtc
atgggcagctattgtccctcgtgccgatatccatgcttccctactgacctgcagagtccg
gtcaagtcctttctgagcatcttgaattctctgatggtgaagtgtcctgcccaagagtgc
aatgaggaagtaagtctggaaaaatataaccaccatgtctcaagccacaaagaatctaaa
gagactttggtgcatattaataaagggggccggcctcgccagcatctcctgtcactgacg
cgaagggctcagaaacatcggctgagggagctcaagattcaagtcaaagaatttgcagac
aaagaagaaggtggagatgtgaagtctgtgtgcttgacgttgttcctgctggcactgagg
gcaaggaatgagcacagacaagctgatgagctcgaggccatcatgcaaggccggggctcc
ggtcttcaaccagctgtttgcttggccatccgtgtcaataccttcctcagctgtagccaa
taccataagatgtacaggacggtgaaagctatcactgggaggcagatttttcaacctttg
cacgctcttcgcaatgctgagaaggtcctcctaccaggctaccacccctttgagtggcag
ccccctctgaagaacgtgtcctccagaactgacgttggaattattgatgggctctctgga
cttgcctcctccgtagatgaatacccagtggacacaattgcaaagaggttccgctatgac
tctgctttggtgtctgctttgatggacatggaggaagacatcttggacggcatgagatcc
caagatcttgatgactacgtgagtggtcccttcaccgtggtggtaaaggaatcgtgtgat
ggaatgggggatgtgagtgagaagcacgggagtgggcccgcagttccagaaaaggcagtt
cggttctctttcaccgtcatgagagttacagtagagcatggctctcagaacgtgaagata
tttgaggaacccaagcccaattctgaactgtgttgcaagccactgtgccttatgctggca
gatgagtctgaccacgagacacttactgctattctcagccccctcatcgctgagagggag
gccatgaagagcagtgaattgctgctggagatgggaggcatccccaggacttttaaattt
atcttcaggggcactggatatgacgagaaacttgtcagggaagtagaaggcttggaagct
tctggctcagtctacatttgtacactttgtgatgccacccgtctggaagcctcccaaaat
cttgtcttccactccataaccagaagccacgccgagaatctgcagcgctatgaggtctgg
cggtccaatccctatcacgagtcagtggaagaactccgggaccgggtgaaaggagtctct
gccaaacctttcatcgagacagtcccttccatagatgcgcttcactgtgacattggaaat
gcagctgaattctataagattttccagctggagataggggaagtgtataaaaatcccaat
gcctctaaagaggaaaggaagagatggcaggccaccttggacaaacatctgcggaaaagg
atgaacttaaaaccaatcatgaggatgaatggcaactttgcccggaagcttatgacccaa
gagactgtggacgcagtttgtgagttaattccttctgaggagaggcacgaagctctcagg
gagctgatggacctttacctgaagatgaaaccggtgtggcgctcatcgtgtcctgctaaa
gagtgcccggagtccctttgtcagtacagtttcaactcacagcgtttcgctgagctcctc
tccaccaagttcaaatacagatacgagggcaaaatcaccaattactttcacaaaaccttg
gcacacgtccctgaaattattgaaagggatggctctattggggcatgggcaagtgagggc
aatgagtctggtaacaaactgtttaggcgcttccggaaaatgaatgccaggcagtccaag
tgctatgagatggaagatgtcctgaaacaccactggctgtatacttcaaaatacctccag
aagtttatgaatgcccataatgcattaaaaaactctgggtttaccatgaactcaaaggag
actttaggggactctttggacattgaggactctctggaaagccaagattcaatggagttt
taa

DBGET integrated database retrieval system