KEGG   Rattus norvegicus (rat): 85251
Entry
85251             CDS       T01003                                 

Gene name
Col18a1
Definition
(RefSeq) collagen alpha-1(XVIII) chain precursor
  KO
K06823  collagen type XVIII alpha
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04974  Protein digestion and absorption
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09154 Digestive system
   04974 Protein digestion and absorption
    85251 (Col18a1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    85251 (Col18a1)
   00535 Proteoglycans [BR:rno00535]
    85251 (Col18a1)
   00536 Glycosaminoglycan binding proteins [BR:rno00536]
    85251 (Col18a1)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   85251 (Col18a1)
Proteoglycans [BR:rno00535]
 Extracellular matrix (ECM) proteoglycans
  Basement membrane proteoglycans
   85251 (Col18a1)
Glycosaminoglycan binding proteins [BR:rno00536]
 Heparan sulfate / Heparin
  Extracellular matrix molecules
   85251 (Col18a1)
Motif
Pfam: Endostatin Collagen Collagen_trimer Laminin_G_3 Laminin_G_2 DUF1554
Other DBs
NCBI-GeneID: 85251
NCBI-ProteinID: NP_445941
RGD: 70936
Ensembl: ENSRNOG00000001229
UniProt: F1LR02
Position
20
AA seq 1311 aa
MAPRWHLLDMLTSLVLLLVARVSWAEPENVAEDVGLLQLLGDPLPQKISQVEDPHVGLAY
VFGPYSKSSQMAQYHFPKLFFRDFSLLFEVRPTTEAAGVLFAITDAAQVVVSLGVKLSEV
RDGQQNISLLYTEPGASQTQTGASFRLPAFVGQWTHFALSVDGSSVALYVDCEEFQRVPF
ARSPHGLELERGAGLFVGQAGAADPDKFQGMISELRVRKTPRVSPVHCLDEEDDDDDRAS
GDFGSGLEESSNLHRQETYLRPGLPQPPPVTSPPLAGGSATEDSRTEEKEEEATVDSKGA
DTLPVTDSSGVWDGDVQNPGGGLIKGGLKGQKGEPGAQGPPGPAGPQGPAGPAVQSPSSQ
PVPGAQGPPGPQGPPGKDGIPGRDGEPGDPGEDGRPGDTGPQGFPGTPGDVGPKGEKGDP
GIGPRGPPGPPGPPGPSFRQDKLTFIDMEGSGGFSGDLESLRGPRGFPGPPGPPGVPGLP
GEPGRFGVNSSYAPGPAGLPGVPGKEGPPGFPGPPGPPGKEGPPGVAGQKGSVGDAGSPG
PKGSKGDLGPIGMPGKSGLPGLPGPVGPPGPPGPPGPPGPGFAAGFDDMEGSGTPLWSTA
RSSDGLQGDPGVTGPPGAKGEVGADGVQGIPGLPGREGVAGPPGPKGEKGTQGEKGNPGK
DGVGRPGLPGPPGPPGPVIYVSNEDRAVVSTPGPEGKPGYAGFPGPAGPKGDLGSKGEQG
LPGPKGEKGEPGSIFSPDGTALGQAQKGAKGEPGFRGPPGPYGRPGYKGEIGFPGRPGRP
GTNGLKGEKGEPGEASLGFSMRGLPGPPGPPGPPGPPGVPVYDSNAFVESGRPGLPGQQG
VQGPPGPKGDKGEVGPPGPPGQFPIDLFHLEAEMKGDKGDRGDAGRKGERGEPGAPGGGF
FSSSVPGPPGPPGYPGIPGPKGESIRGPPGPPGPQGPPGIGYEGRQGPPGPPGPPGPPSF
PGPHRQTVSVPGPPGPPGPPGPPGAMGASAGQVRIWATYQTMLDKIREVPEGWLIFVAER
EELYVRVRNGFRKVLLEARTALPHGTDNEVAALQPPLVQLHEGSSYTRREHSYPTARPWR
ADDILANPPRLPDRQPYPGVPHHHHHHHHHHSSHEHRPPAHPSPSPAHTHQDFHPVLHLV
ALNTPLSGGMRGIRGADFQCFQQARAVGLSGTFRAFLSSRLQDLYSIVRRADRSSVPIVN
LKDEVLSPSWDTLFSGSQGQLHSGARIFSFDGRDVLRHPAWPQKSVWHGSDPSGRRLMES
YCETWRTEATGVTGQASSLLSGRLLEQKAESCHNSYIVLCIENSFMTSFSK
NT seq 3936 nt   +upstreamnt  +downstreamnt
atggcgcccaggtggcacctcctggacatgctcaccagtttggtcttgctgctggtggca
cgcgtctcctgggcagagccagagaatgttgctgaagatgtggggctcctgcagctcctc
ggagaccccctaccccagaagatctcccaagtcgaagaccctcatgtcgggctggcctac
gtctttggaccatactccaaaagtagtcagatggcccagtatcacttccctaaactcttc
ttccgggacttttcgctgctgttcgaagtccggccaaccacagaggccgcaggggtgctg
tttgctatcacagatgccgcccaggtggtggtctcgctaggcgtgaagctctcagaggtc
cgagatggacaacagaacatctcattgctctacacggagcccggggccagccagacccag
acgggagccagcttccgcctacctgcgtttgttggccagtggacacacttcgcgctcagc
gtggatggaagctccgtggctctctacgtagactgtgaagagttccagagagtgccgttc
gctcggtccccacacggtctggagctagagcgtggcgctggcctctttgtgggtcaggct
ggagcagcggaccctgacaagttccagggaatgatctcagagctgagagtacgcaaaacc
ccccgggtgagccctgtgcactgcctggatgaagaagatgatgatgacgaccgggcatct
ggagattttggaagtggcctcgaagaaagcagcaatttacacaggcaggagacatatcta
cgacccgggctcccccagccacctcctgtcacttccccgcccttggctggaggcagtgcc
accgaagattctaggacagaagaaaaggaggaagaagccacggtagattctaaaggagct
gatacccttcctgtcacagattcaagcggtgtgtgggacggggatgtccagaaccctgga
ggtggcttgataaagggaggtctcaaaggacaaaagggagagccaggtgctcaaggccca
cctggcccagctgggccccagggtcctgccggtccagcggtacagagccccagctcacaa
cctgtccctggagcacaaggacccccgggacctcagggaccaccagggaaggatggcatc
ccgggaagggatggtgaaccaggcgaccctggtgaagacgggaggccgggtgacactgga
cctcaaggcttcccggggaccccaggagatgtgggccctaagggtgagaagggagatcct
ggtattgggcctcgaggacctccaggacctccgggaccaccaggaccctccttcagacag
gacaagctgaccttcattgacatggagggatctggtggtttcagcggagacctagagagc
ctcagaggcccacgaggcttccctggtcccccaggtccccctggtgtcccaggactgcct
ggtgaaccagggcgctttggagtcaacagttcctacgcaccaggacctgcaggccttcct
ggtgtgcctgggaaggaagggccccctggttttcctggtcccccaggacctccaggcaaa
gagggcccaccaggagtggccggccagaaaggcagtgttggcgatgcaggcagcccagga
cccaaggggagcaaaggagaccttgggcccattggtatgcctgggaagtctggcttgccg
ggactccctgggccagttggacccccaggacctccagggcctccagggccaccaggacca
ggatttgctgctggatttgatgacatggaaggttctggaacacctctctggtcaacagcc
cgaagctccgatgggctgcagggggatcctggagtgactgggccacctggggccaaggga
gaagttggagcagacggagtccagggcatccctggtctcccaggaagagagggtgtagct
gggcccccgggacccaaaggagagaaagggacccagggagaaaagggaaacccaggaaaa
gatggagtaggtcggccaggcctccctggccctccaggccccccagggcctgtgatctat
gtgtcaaatgaggatagagctgtagtaagcacgccgggacctgagggcaagccagggtac
gcaggctttcctggacctgctggaccgaagggtgacctgggttccaaaggcgagcagggt
cttccagggcccaagggtgagaagggagaaccaggcagtatctttagccctgatggcaca
gccctgggccaggcccagaagggagccaagggagaaccaggcttccgaggacccccgggt
ccttatggacggcctgggtacaagggtgaaattggcttccctggacggccgggtcgtccc
ggaacaaatggcttaaagggagagaaaggggagcctggagaggccagccttgggttcagc
atgaggggactgcctggcccccctgggcctccaggccccccaggtcctcccggagtgccc
gtctatgacagcaatgcatttgtggagtctggccgacctggactaccaggacagcaaggt
gtgcaggggcctccaggaccaaagggtgacaaaggagaggtgggcccacccgggccacca
gggcagttccccattgacctcttccacctggaagccgaaatgaagggggacaagggagac
cgaggggatgctggacggaagggagagaggggagagcctggggctcctggtggtggattc
ttcagctcaagtgtacctggaccacctggcccacctggataccctggaattccgggtcca
aaaggagagagcattcggggtccgcctggccctcctggcccgcagggacctcctggcatt
ggatatgaggggcgccagggccccccaggacctccaggacctccaggacctccctcattc
cctggccctcatagacagactgtcagtgttcctggtcctccaggcccacctggcccccca
ggtcccccaggagccatgggtgcctctgctgggcaggtaaggatctgggctacataccag
accatgttggacaagatacgtgaggtgccagagggctggctcatctttgtggccgagagg
gaagagctctacgtacgggttagaaatggcttccgtaaggtgctgctggaggcccggaca
gccctcccgcacgggacggacaacgaggtagctgccttgcaacctccattggtacagctt
catgagggcagttcatatacccggagggagcactcctatcccacggcacgaccctggcga
gcagatgacatcttggccaacccaccacgtctgccggaccgccagccttacccgggagtt
ccacaccaccaccaccaccaccaccaccaccacagttctcatgaacaccggccgccagcc
cacccctccccctcacctgcccatactcaccaggactttcacccagtgctccacctggtg
gcactgaacacccctctgtctggaggcatgcgtggtatccgtggggctgacttccagtgc
ttccagcaagcccgagccgtggggctgtctggcacctttcgggccttcctgtcctctagg
ctgcaggacctctacagcattgtacgccgtgctgaccgcagctctgtgcccatcgtcaac
ctgaaggatgaggtactatctcccagctgggacaccctgttctccggctcccagggtcaa
ctgcactctggggcccgcatcttttctttcgacggcagagacgtcctgagacacccagcc
tggccacagaagagcgtatggcatggctcagaccccagtgggcgcaggctgatggagagc
tactgtgagacgtggaggactgaagctactggggttacaggtcaggcctcttccctgctg
tcgggcaggctcctggaacagaaggccgagagctgccacaacagctatatcgtcctgtgc
attgagaatagcttcatgacctctttctccaaatag

DBGET integrated database retrieval system