KEGG   Rattus norvegicus (rat): 85490
Entry
85490             CDS       T01003                                 

Gene name
Col5a1
Definition
(RefSeq) collagen alpha-1(V) chain precursor
  KO
K19721  collagen type V/XI/XXIV/XXVII, alpha
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04974  Protein digestion and absorption
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09154 Digestive system
   04974 Protein digestion and absorption
    85490 (Col5a1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:rno00536]
    85490 (Col5a1)
Glycosaminoglycan binding proteins [BR:rno00536]
 Heparan sulfate / Heparin
  Extracellular matrix molecules
   85490 (Col5a1)
SSDB
Motif
Pfam: Collagen COLFI Laminin_G_2 Laminin_G_1 Laminin_G_3
Other DBs
NCBI-GeneID: 85490
NCBI-ProteinID: NP_604447
RGD: 70920
Ensembl: ENSRNOG00000008749
UniProt: Q9JI03
Position
3
AA seq 1840 aa
MDVHTRWKAPRPGAPLLSSPLLLLLLLLWAPPPSRAAQPTDLLEMLDFHNLPSGVTKTTG
FCATRRSSKEPDVAYRVSKDAQLSMPTKQLYPESDFPEDFSILTTVKAKKGSQAFLVSVY
NEQGIQQLGLELGRSPVFLYEDHTGKPGPEEYPLFPGINLSDGKWHRIAISVYKKNVTLI
LDCKKKITKFLNRGDHPIIDVNGIIMFGSRILDDEIFEGDIQQLLFVSDHRAAYDYCEHY
SPDCDTAVPDTPQSQDPNPDEYYPEGEGETYYYEYPYYEDPEDPGKEPAPSQKPVEAARE
TTEVPEEQTQPPSEAPTVPETSDTAGKEDNPGIGDYDYVPTDDYYTTSPYEDFGYGEGVE
NPDQPTNPDSGAEIPTSTSVTSNSSNPAPSPEEGKDDLGGEFTEETIKNLDENYYDPYFD
PDSDSNVSPSEIGPGMPANQDTIYEGIGGPRGEKGQKGEPAIIEPGMLIEGPPGPEGPAG
LPGPPGTTGPTGQMGDPGERGPPGRPGLPGADGLPGPPGTMLMLPFRFGGGGDAGSKGPM
VSAQESQAQAILQQARLALRGPAGPMGLTGRPGPMGPPGSGGLKGEPGDMGPQGPRGVQG
PPGPTGKPGRRGRAGSDGARGMPGQTGPKGDRGFDGLAGLPGEKGHRGDPGPSGPPGLPG
DDGERGDDGEVGPRGLPGEPGPRGLLGPKGPPGPPGPPGVTGMDGQPGPKGNVGPQGEPG
PPGQQGNPGAQGLPGPQGAIGPPGEKGPLGKPGLPGMPGADGPPGHPGKEGPPGEKGGQG
PPGPQGPIGYPGPRGVKGADGIRGLKGTKGEKGEDGFPGFKGDMGIKGDRGEIGPPGPRG
EDGPEGPKGRGGPNGDPGPLGPTGEKGKLGVPGLPGYPGRQGPKGSIGFPGFPGANGEKG
GRGTPGKPGPRGQRGPTGPRGERGPRGITGKPGPKGNSGGDGPAGPPGERGPNGPQGPTG
FPGPKGPPGPPGKDGLPGHPGQRGETGFQGKTGPPGPPGVVGPQGPTGETGPMGERGHPG
PPGPPGEQGLPGAAGKEGTKGDPGPAGLPGKDGPPGLRGFPGDRGLPGPVGALGLKGSEG
PPGPPGPAGSPGERGPAGAAGPIGIPGRPGPQGPPGPAGEKGVPGEKGPQGPAGRDGLQG
PVGLPGPAGPVGPPGEDGDKGEIGEPGQKGSKGDKGEQGPPGPTGPQGPIGQPGPSGADG
EPGPRGQQGLFGQKGDEGSRGFPGPPGPVGLQGLPGPPGEKGETGDVGQMGPPGPPGPRG
PSGAPGADGPQGPPGGIGNPGAVGEKGEPGEAGEPGLPGEGGPLGPKGERGEKGEAGPSG
AAGPPGPKGPPGDDGPKGSPGPVGFPGDPGPPGEPGPAGQDGPPGDKGDDGEPGQTGSPG
PTGEPGPSGPPGKRGPPGPAGPEGRQGEKGAKGEAGLEGPPGKTGPIGPQGAPGKPGPDG
LRGIPGPVGEQGLPGSPGPDGPPGPMGPPGLPGLKGDSGPKGEKGHPGLIGLIGPPGEQG
EKGDRGLPGPQGSSGPKGEQGITGPSGPLGPPGPPGLPGPPGPKGAKGSSGPTGPKGEAG
HPGLPGPPGPPGEVIQPLPIQASRTRRNIDASQLLDDGAGESYVDYADGMEEIFGSLNSL
KLEIEQMKRPLGTQQNPARTCKDLQLCHPDFPDGEYWVDPNQGCSRDSFKVYCNFTAGGS
TCVFPDKKSEGARITSWPKENPGSWFSEFKRGKLLSYVDAEGNPVGVVQMTFLRLLSASA
QQNITYNCYQSVAWQDAATGSYDKAIRFLGSNDEEMSYDNNPYIRALVDGCATKKGYQKT
VLEIDTPKVEQVPIVDIMFTDFGEASQKFGFEVGPACFLG
NT seq 5523 nt   +upstreamnt  +downstreamnt
atggacgtacacacccgctggaaagctccgcgcccgggcgccccgctgctgtcctcgccg
ctgctcctgctcctgctgctgctgtgggcgccgcctccgagccgcgcagctcagccaaca
gatcttctggagatgctagattttcacaatttgccctcaggcgtaacgaaaaccacaggt
ttctgtgccactcgacgatcttccaaagagccggatgttgcctaccgagtctctaaagat
gcacagctcagcatgcccaccaagcagctgtaccctgagtctgactttcctgaggacttc
tccatcctgacaaccgtgaaagccaagaaaggcagtcaggccttcctggtctccgtttac
aatgagcagggcatccagcagttgggactggagctgggccgctcccctgtcttcctctat
gaggaccacacagggaagcccgggcctgaagagtatccactcttccctggcatcaacctg
tccgatggcaagtggcaccgaatcgctatcagtgtatacaagaaaaatgtcaccttgatc
ctcgactgtaaaaagaagatcacgaagttcctcaaccgcggcgaccaccccataatagat
gtcaacggtatcatcatgtttggctcccggattctggatgatgaaatatttgagggtgac
atccaacagttgctcttcgtctccgaccaccgagctgcctatgattactgtgagcactac
agccccgactgtgacacagcggtccctgacacacctcagtcacaggaccctaacccagat
gaatattacccagaaggagagggtgagacctattactatgagtacccatattatgaagac
cctgaagacccgggaaaggagcccgccccctctcagaagccagtggaagccgccagagaa
accacggaggttcctgaggagcagacccagcccccatccgaagcccctacagtgcctgag
accagtgacacggctggcaaggaggacaatccagggatcggggactacgactatgtgccc
actgacgactactacactacatccccgtatgaagacttcggctatggcgagggcgtggag
aaccccgaccagcccaccaaccctgactcaggggccgagatccccaccagcaccagtgtt
acctccaattcctccaatccggctccatctccagaggaagggaaggatgacctgggaggt
gagttcaccgaggagaccatcaagaatctagatgaaaactactatgacccgtactttgac
ccggactccgactccaatgtctctccatcggagatagggccaggcatgcctgctaaccag
gacaccatctatgaagggattggaggaccccgaggtgagaaagggcaaaagggagaacca
gccatcattgagccgggaatgctgatagaggggccccctggccctgaaggccctgctggt
cttccaggacctccaggaactacgggtcctactggccaaatgggtgaccctggagaaagg
ggtccccctgggcgcccaggtcttcctggggctgatggcttgcctggtccccccgggacc
atgctcatgctgccgttccgttttggaggtggtggcgacgccggttctaagggccccatg
gtctctgcccaggaatcccaggcacaggctatcctccagcaagccaggttggcactaagg
ggaccagctggtccaatgggtctcaccgggagacctggccccatgggtcctcctgggagt
ggaggtttgaagggtgagccaggagacatgggacctcagggtcctcgaggtgtgcaaggt
ccacccggcccaacagggaagcctggaagacggggccgtgctgggagtgatggtgccaga
ggcatgcctggacaaacaggccccaagggtgaccgtggctttgatggtctggctgggttg
ccgggagagaaaggccatagaggtgaccctggtccttctggcccgccgggactcccagga
gatgatggagaaaggggtgacgatggagaagttgggcccagggggctgcctggggagcct
ggaccacgtggtctgcttgggccaaaaggcccccctggcccacctggacctcctggtgtg
acgggtatggatggccagcctggccccaaaggaaatgtgggtccccagggagagcctggg
cccccaggacagcagggtaatcctggtgcccagggtcttcccggtccccagggtgccatt
ggtcctccaggagaaaagggtcctttggggaaaccaggtctcccaggaatgcccggagct
gatggacccccggggcaccctggcaaagaaggtcctccaggagagaaaggaggccagggt
cctcccggcccccagggtcccattggctacccaggtccacgaggagtcaagggggcagat
ggcatccgagggctgaagggcaccaagggagagaagggtgaagacggcttccctgggttt
aaaggcgacatgggaataaagggtgaccggggggagatcggcccacccggcccccgagga
gaagatggtcctgaaggcccaaaaggtcgaggtggtcccaatggtgatcctggtcccctg
gggcccaccggggagaagggaaagctcggagtgcctggattaccagggtacccaggaaga
caagggccaaagggttctattggattccctggcttcccgggcgccaacggagagaaaggt
ggcagggggacacctggaaagccaggaccacggggacagcgaggcccaacgggcccgagg
ggtgaacgaggcccacggggcatcactgggaagcctggccctaagggcaactcaggaggt
gatggcccagccggccctcctggtgagcggggacccaatggaccccaaggccccaccggc
ttccctggacctaagggtcccccgggtccaccaggcaaggacgggctccccggacatcct
gggcagagaggggagactggtttccaaggcaagactggccctccaggccctccaggagtg
gttggccctcagggtcccacaggcgagacgggtcccatgggagagcgtggccaccctggt
cctccaggcccccctggtgaacagggcctcccaggtgctgctgggaaagaagggacgaag
ggtgacccaggtcctgctggcctccctgggaaggatggacctccaggattgcgtggattc
cctggggaccgagggctccccggccccgtgggagcactcggactgaaaggcagcgaaggc
ccccctggccccccaggtcctgcgggttctccaggggagagaggaccagctggtgctgct
ggacccattggaattccagggagacctgggcctcagggacctccggggcctgctggagag
aaaggggttcctggagagaaaggtccgcaaggcccggctggccgagatggcctgcaaggt
cccgtggggctccctggaccagccggccccgtgggtcctcctggagaagatggagataag
ggagagatcggagagcccgggcagaaagggagcaagggcgacaaaggcgagcagggtcct
cctgggcctaccggtcctcaaggccccattgggcagccaggcccttcgggagcagatggt
gaacctggccctcgtggacagcagggcctgtttgggcagaaaggagatgaaggttcaaga
ggtttcccaggaccgccagggccagtgggcttgcagggtttaccaggacctccaggagaa
aagggtgagacaggagacgtgggccagatgggccctcctggtccaccaggcccccgagga
ccctctggagctccaggagctgatgggccacagggtcctccaggagggattggcaaccct
ggtgcagtcggagaaaagggagagcctggcgaagctggagagcctggccttccaggagaa
ggaggtcccctgggacctaaaggagaaagaggggagaagggagaggctggcccctctggt
gctgctggaccccctggacccaaaggcccacctggagatgatggccccaaaggcagcccc
ggccccgtgggctttcctggagaccctgggccccctggagagccaggcccagcaggtcaa
gatggcccacctggtgacaaaggggatgatggagaacctgggcagacgggatccccaggc
cctactggtgaacctggtccatctgggcctccaggaaagaggggtccaccgggccctgca
ggccctgaaggcaggcagggggagaaaggagccaagggagaagctggcttagaaggccct
cctgggaagactggccccattggtccccaaggggcccctgggaagcctggccctgatggt
cttcgtgggatccctggtcctgtgggtgagcaaggcctcccaggatccccaggccctgat
ggtccacccggccccatgggtcctccaggactccctggcctcaaaggagactccggtccc
aaaggtgaaaagggccatccgggcctgattggactcatcggacctccgggcgaacaaggt
gaaaaaggtgaccgaggactcccaggcccccagggctcatctggtcctaaaggagaacag
ggcattacaggtccttctggcccgcttgggcctcctggtcccccaggcttgccgggccct
ccaggtcccaaaggtgctaaaggttcatcgggtcccactggcccgaagggcgaggcaggc
catccaggactccctggtccacccgggcctccaggcgaggtcatccagcccctgccaatc
caggcgtccaggactcggcggaacattgatgccagtcagctcctggatgatggggctggg
gagagctacgtggattatgcagatggcatggaagagatctttggttccctcaactccctg
aagctggagattgagcagatgaagcggccactgggcacacagcagaacccagcccgtacc
tgcaaggaccttcaactctgccatcctgatttcccagacggcgaatactgggtcgatccc
aaccaagggtgctccagggactccttcaaagtctactgcaatttcacagctggagggtcc
acgtgcgtcttccctgacaagaagtctgagggagccagaatcacttcttggcccaaagaa
aacccaggttcctggttcagtgaattcaagcgtgggaaactgctctcctatgtggatgct
gaaggcaaccctgtgggcgtggtacaaatgaccttcctgcggctgctgagtgcctctgcc
cagcagaacatcacctacaactgctaccagtccgtggcctggcaggatgccgccacaggc
agctacgataaggctatccgcttcttgggctccaacgatgaggaaatgtcttatgataac
aacccctacatccgtgccctggtggatggctgtgctaccaagaaaggctaccagaagacg
gtgctggagattgacacgcccaaagttgagcaagtccccattgtggacatcatgttcacc
gactttggtgaagcctcacagaaatttggatttgaagtagggccagcttgcttcctaggc
tag

DBGET integrated database retrieval system