KEGG   Blautia obeum: CK5_30710
Entry
CK5_30710         CDS       T02605                                 

Definition
(GenBank) xanthine dehydrogenase, molybdenum binding subunit apoprotein
  KO
K00087  xanthine dehydrogenase molybdenum-binding subunit [EC:1.17.1.4]
Organism
rob  Blautia obeum
Pathway
rob00230  Purine metabolism
rob01100  Metabolic pathways
rob01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:rob00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    CK5_30710
Enzymes [BR:rob01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.1  With NAD+ or NADP+ as acceptor
    1.17.1.4  xanthine dehydrogenase
     CK5_30710
SSDB
Motif
Pfam: Ald_Xan_dh_C2 Ald_Xan_dh_C
Other DBs
NCBI-ProteinID: CBL24297
UniProt: D4LU39
Position
complement(3107280..3109556)
AA seq 758 aa
MIGKSVPRVDAYEKVTGRAKFTEDLLPKRCLVAKVLHATIGNGIVKSIDTSEAEIMEGVV
KVVTFHDVPDHCYPTPGHPWSVELAHQDVADRNLLTGRVRYYGDDIAAVVAEDEIIASRA
LKKIKVEYEEYPVEIHPRKSMYGSKPPIHFDKKDNVLARSNYFIGDVDKGMEEAETVVKG
TYKTPIVQHCHIENPISYAYMEKGRIVVVTSTQIPHIVRRVIGQALGIPWGNVRVIKPYI
GGGFGNKQDVLYEPLNAFLTTQVGGRPVKLDISREETFCNTRTRHAIEFDLAAGVDKEGK
LIAKDMHSYSNQGAYASHGHAIAANGLTSWRLQYACPNIRGEAYTIYTNTPVGGAMRGYG
IPQVCFAIECFMDDVAEAIHMDPLEFRRKNLIEGYYEDRYLKPIAANTNGIFECLKKGAE
YIHWDEKRKKYAKQTGAVRRGVGMALFSYKTGVWPISLEIAGARLSLNQDGSVQLQLGAT
EIGQGADTVFSQMVAETLHTDMAHVHIQTVQDTDVSPFDTGAYASRQSFVTGTAVKHCAE
ILRDKILAYAKTLLPEIDTRELSLRDNWIWADEEQVISLAALAEESYYSLTNSSVLTAEV
SEQVKKNTIATGCCFAEVEVDIKLGKIKILHIINVHDSGKLLNPQLAEMQVHGGMSMGMG
YGISEQLILDEKTGRPLNGNLLDYKLMTMLDTPDIKAGFVEMDDPMGPYGNKALGEPPAI
PSAPAIRNAVLHATGVAFNENPLTPQRLIDGFKKAGLI
NT seq 2277 nt   +upstreamnt  +downstreamnt
atgatcggaaaaagtgttccgcgtgtagacgcatatgagaaagtcaccggaagagcaaaa
tttacagaagatctacttccgaaaagatgtctggtggcgaaagtgttgcatgcaacaatt
ggaaatggaatcgtaaaatctattgatacaagtgaggccgagatcatggaaggggtggtg
aaggttgtgacgttccatgatgtcccggatcattgctatccgacaccgggacatccatgg
tctgtggaactggcacatcaggatgtggcagacaggaatctgctgaccggtcgtgtgcgc
tattatggagatgatattgcagcggttgttgcggaggatgaaattattgcatccagagcg
ttgaaaaagatcaaagtagaatatgaggaatatccggttgagattcatccgcgtaaatcc
atgtatggaagcaaaccgccgattcatttcgataaaaaagataacgtacttgcccgttca
aattattttatcggagatgtcgataaaggtatggaagaagccgaaacggtggtaaaaggc
acatacaagactccaatcgtacagcattgtcatatcgaaaacccgatttcgtatgcctat
atggaaaaaggacggatcgtggttgtgacatctacgcagattccgcatatcgtgcgtcgt
gtcattggtcaggcgctgggaatcccgtggggcaatgtccgtgtgatcaagccatatatc
ggaggtggattcggaaataagcaggatgtcttatatgaaccactgaatgctttcctgaca
acgcaggtgggcggcagaccggttaaactggatatcagcagagaagaaactttctgcaat
acgagaacccgtcatgctattgaatttgatcttgccgcaggcgtggataaagaaggaaag
cttattgcaaaggatatgcactcttattccaatcagggcgcttatgcatcacacggtcat
gcgatcgcagcgaacggtctgacttcatggagactgcaatatgcctgtccgaatatccgc
ggggaggcttatacaatctataccaacacaccggtaggcggtgcaatgcgaggttacggc
attccgcaggtatgcttcgcaatagagtgctttatggatgatgtggcagaggcaatccac
atggatccactggaattccgcaggaaaaacttaattgaaggatattatgaagaccgttat
ctgaaaccgatcgctgcaaatacgaacggtatttttgaatgcttgaaaaagggtgcagaa
tatattcattgggatgaaaaaagaaaaaaatatgcaaagcagacaggagcggtacgcaga
ggggtaggtatggctctgttttcgtataaaaccggtgtatggccgatctcactggaaatc
gcaggggcacgtctttcgctgaatcaggatggcagtgtgcagcttcagcttggtgcaacg
gagatcggacagggagcggatacagtattttcacagatggttgcagaaacacttcataca
gatatggctcatgtacacatccagactgtgcaggatacggacgtatccccgtttgatacg
ggagcctatgcttccagacagtcttttgtaaccggaaccgcagtgaaacactgtgcagaa
attttaagagacaagattctggcttatgcaaagactttactgccggagatagataccaga
gaattaagtcttcgtgataactggatctgggcagacgaagaacaggtaatttcacttgct
gctttggcagaagaaagttattacagcctgacgaattcttctgtactgacagcagaagta
tctgaacaggtaaagaaaaatacgattgcaaccggctgttgttttgccgaagttgaagta
gacatcaaacttggaaagataaagattcttcatatcatcaatgtacatgacagtggaaaa
cttctgaatccacagcttgccgaaatgcaggtacatggtggtatgtcgatgggcatgggc
tatggcatcagtgagcagctgattcttgacgaaaagacaggaagacctttaaacggtaat
cttctggactataaactgatgacgatgctggatacgccggacatcaaagcaggttttgtg
gaaatggatgatccgatgggtccatatggaaacaaagctcttggagaaccgccggcaatt
ccgagtgcaccggcaattcgtaatgcagtgcttcatgcaaccggtgttgcatttaatgaa
aatccgctgacaccacagcgtctgatcgacggattcaaaaaagcaggacttatctga

DBGET integrated database retrieval system