KEGG   Raoultella ornithinolytica B6: RORB6_17420Help
Entry
RORB6_17420       CDS       T02625                                 

Definition
(GenBank) PTS system mannose/fructose/sorbose family transporter subunit IIB
  KO
K02813  sorbose PTS system EIIB component [EC:2.7.1.206]
Organism
ror  Raoultella ornithinolytica B6
Pathway
ror00051  Fructose and mannose metabolism
ror01100  Metabolic pathways
ror02060  Phosphotransferase system (PTS)
Brite
KEGG Orthology (KO) [BR:ror00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    RORB6_17420
 09130 Environmental Information Processing
  09131 Membrane transport
   02060 Phosphotransferase system (PTS)
    RORB6_17420
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ror02000]
    RORB6_17420
Enzymes [BR:ror01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.206  protein-Npi-phosphohistidine---L-sorbose phosphotransferase
     RORB6_17420
Transporters [BR:ror02000]
 Phosphotransferase system (PTS)
  Enzyme II [TC:4.A]
   Sorbose-specific II component
    RORB6_17420
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PTSIIB_sorb PH_TFIIH
Motif
Other DBs
NCBI-ProteinID: AGJ88165
Position
3826337..3826831
Genome map
AA seq 164 aa AA seqDB search
MNITLARIDDRLIHGQVTTVWSKVANARRIIICNDEVYNDEVRRTLLRQAAPPGMKVNVV
NLEKAVAVYHNPQYQNETVFYLFTNPQDVLTMVKQGVNIATLNIGGMAWRPGKKQLTKAV
SLDDEDIHAFRQLDNLGVKLDLRVVASDPSINILDKIAEHTATE
NT seq 495 nt NT seq  +upstreamnt  +downstreamnt
atgaacattacgcttgcccgtattgatgaccgcctgatccatggccaggtgaccaccgtg
tggtcaaaagtcgccaacgcccggcgcattattatctgcaacgacgaggtctataacgat
gaggtacgtcggaccttactccgccaggccgcgcctccgggcatgaaggtcaatgtcgtt
aacctcgaaaaagcggtcgccgtttatcacaacccgcaatatcagaacgagaccgttttt
tatttatttaccaaccctcaggatgttttaacgatggtcaaacagggggtcaatattgcc
accttaaatattggtggcatggcctggcgaccgggtaaaaaacaattaaccaaggcagtc
tctttagacgacgaggatattcatgcatttcgtcaactggataatctgggcgtaaaactg
gatttgcgtgtggtggcatcagatccgtccattaatatcctcgacaaaatagccgagcac
actgccacagaataa

DBGET integrated database retrieval system