KEGG   Ralstonia pickettii 12D: Rpic12D_0667
Entry
Rpic12D_0667      CDS       T00925                                 

Definition
(GenBank) DEAD-like helicase
Organism
rpf  Ralstonia pickettii 12D
SSDB
Motif
Pfam: ResIII SNF2_N Helicase_C DUF2075 AAA_30
Other DBs
NCBI-ProteinID: ACS61968
UniProt: C6BE08
Position
1:699835..702117
AA seq 760 aa
MSLDTDVVPAAEGTPIQGDLLEAAASSLAMSLQDFVAEFGDELLDSLNRANPPVYTGQAR
PHRQIVLASLKRKLFQAQAEVVHAVIELLADRGERAAIVNGEMGCGKTTVGIATAAVLHA
EGYRRTLVLSPPHLVYKWRREIQETVAGAKVWVLNGPDTLVKLIKLREQLGVPARGQEFF
VLGRVRMRMGFHWKPVFNVRRTRHGEVGACPDCGQIITNLDGEPINPVELEAEDYRRRCS
HCAAPLWTLMRPRSLSASDQSTAVFKALQRIPTIGEVTAQKLMRKFGDSFLASMLGDNIH
EFINLMDGNGELVFSDRQAHRMERAMANMEFGFGEGGYQPSEFIKRYLPQGTFDLLIADE
AHEYKNGGSAQGQAMGVLAAKARKTLLLTGTLMGGYGDDLFHLLFRALPGRMIEDGYRPT
KSGSMTSAAMAFMRDHGVLKDIYSESTGTAHKTAKGNKVSVRTVKAPGFGPKGVLRCVLP
FTVFLKLKDIGGNVLPPYDEEFREVAMDTAQAAAYRDLSGRLTTALKQALAKRDTTLLGV
VLNVLLAWPDCCFRSETVVHPRTRQTLAFVPAQFNELEVMPKERELIEICKQEKAAGRKT
LVYSVYTGTRDTTSRLKVLLEQEGFKVAVLRASVDASRREDWIAEQLDRGIDVLITNPEL
VKTGLDLLEFPTIVFMQSGYNVYSLQQAARRSWRIGQKQPVRVIYLGYAASSQMTCLGLM
ARKIMVSQSTSGDVPESGLDVLNQDGDSVEVALARQLVAA
NT seq 2283 nt   +upstreamnt  +downstreamnt
atgtccctcgataccgacgttgttcccgccgccgaaggcacgcccatccagggcgacctg
ctcgaagcggctgcttcttccctggcgatgagcctccaggatttcgttgccgaattcggc
gacgagctgctggattcgctcaaccgcgccaatccacccgtctacaccggccaggcccgg
ccgcaccgccagatcgtgctggccagtctcaagcgcaagctgttccaggcgcaggccgag
gtggtgcatgccgtcatcgaactgctggccgaccgtggcgaacgcgccgcgatcgtcaat
ggcgagatgggctgcggcaagacgaccgtcggtatcgccacggccgccgtgctgcacgcc
gaaggctaccgccgcactctggtgctgtcgccgccccacctggtctacaagtggcgccgc
gaaatccaggagacggtggccggtgccaaggtctgggtgctcaatggcccggacacgctg
gtcaagctcatcaagctgcgcgagcagttgggcgtgccggcgcgcggccaggagttcttc
gtgctcgggcgcgtgcggatgcgcatgggtttccactggaagcccgtcttcaacgtgcgg
cgcacgcggcacggcgaagtaggcgcatgcccggactgcggccagatcatcaccaacctc
gacggcgagccgatcaacccggtcgaactcgaagccgaggactaccgccgccggtgcagc
cattgcgccgcaccgctgtggacgctgatgcgaccgaggagcctgtccgccagcgaccag
tccacggccgtcttcaaagccttgcagcgcatcccgaccatcggggaagtcaccgcgcag
aagctgatgcgcaagttcggcgactccttcctggcgtccatgctcggcgacaacatccac
gagttcatcaacctcatggatgggaacggcgagctggtcttctcggatcgtcaagcgcac
cgcatggagcgggcgatggcgaacatggagttcggcttcggcgagggaggctaccagccg
tccgagttcatcaagcgctacctgccgcaaggcacgttcgacctgctcatcgccgacgag
gcgcacgagtacaagaacggcggcagcgcccagggccaggccatgggcgtgttggcggcc
aaggcacgcaagacgctgctgctcaccggcacgctgatgggcggctacggcgacgacctt
ttccacctgctgttccgagccctgccggggcgaatgatcgaagatggctaccgcccgacc
aagagcggcagcatgacctcggccgcgatggcgttcatgcgcgatcacggcgtcctcaag
gacatctattccgagagcaccggcacggcgcacaagacggccaagggcaacaaggtctcg
gtgcgcacggtcaaggcgccgggcttcggcccgaagggcgtgctgcgttgcgtgctgccg
ttcacggtcttcctcaagttgaaggacatcggcggcaatgtgctgccgccctacgacgag
gagttccgcgaggtggcgatggacacggcgcaagccgcggcctatcgcgatctgtcgggt
cggctgaccacagcgctgaaacaggcgctggcgaagcgcgacacgacgctgctcggcgtg
gtcctcaacgtgctgctggcctggccggattgctgcttccggtcggagacggtggtgcac
ccgcgcacgcgccagaccttggccttcgttccggctcagttcaacgagctggaggtgatg
cccaaggagcgcgagctgatcgagatctgcaagcaggagaaggctgcgggtcgcaagacg
ctggtctattcggtctacaccggcacgcgcgacaccacgtcgcgcctgaaggtgctgctg
gagcaggaaggcttcaaggtggcagtgctgcgcgcaagcgtggatgcctcccgccgcgag
gactggatcgccgagcagttggatcgcggcatcgacgtgctcatcaccaacccggagttg
gtcaagaccgggctggacttgttggagtttccgacgatcgtgttcatgcagtcgggctac
aacgtctatagcctgcagcaggcggcccggcgctcgtggcgcatcggccagaagcagccg
gttcgcgtgatctacctcggctacgcggcttcctcgcagatgacctgcctggggctgatg
gcccgaaagatcatggtctcgcaaagcacgtcgggagacgtgcccgaatcgggactggat
gtgctgaaccaggacggtgattccgtcgaggtggcactggcccggcagctcgtcgcggcc
tga

DBGET integrated database retrieval system