KEGG   Ralstonia pickettii 12D: Rpic12D_0695
Entry
Rpic12D_0695      CDS       T00925                                 

Definition
(GenBank) transcriptional regulator, XRE family
Organism
rpf  Ralstonia pickettii 12D
SSDB
Motif
Pfam: HTH_3 HTH_31 HTH_19 HTH_26 HTH_25
Other DBs
NCBI-ProteinID: ACS61996
UniProt: C6BE36
Position
1:complement(725943..726248)
AA seq 101 aa
MQKRSIQRGRPTGTTTYEAEPAIAFGASVREERTSQGIAQETLAHLSGIERSHMGKIERG
EHVPTLPLILKIARALKCSSAHLMALTEAKLAETAPPKSAD
NT seq 306 nt   +upstreamnt  +downstreamnt
atgcaaaagcgttcgattcaaagaggccggcccaccggcacaacaacctacgaagcggaa
ccagccatcgcgtttggggcctccgtgcgcgaagaaagaaccagtcaaggcatcgcccag
gaaacgctggctcatctgtcaggaatcgagcgttcacacatgggaaagatcgagcgtggc
gagcatgtccccacgctccccctcattctcaaaatcgcccgtgcgctgaaatgcagttct
gcccacttgatggcgctgactgaagccaagctggcagagacggctccgcctaaatcagcg
gactga

DBGET integrated database retrieval system