KEGG   Ralstonia pickettii 12D: Rpic12D_0730
Entry
Rpic12D_0730      CDS       T00925                                 

Definition
(GenBank) tol-pal system protein YbgF
Organism
rpf  Ralstonia pickettii 12D
SSDB
Motif
Pfam: TolA_bind_tri YfiO TPR_6 TPR_18 TPR_16 TPR_21 TPR_9 TPR_19 TPR_2 DUF3450 Nsp1_C ANAPC3 RE_Eco47II Phage_GP20 Filament DUF848 Seryl_tRNA_N CLZ GHMP_kinases_C bZIP_1 DUF2205 CENP-H Spc7 ADIP Spc24 Mod_r bZIP_2 ZapB YabA DUF16
Other DBs
NCBI-ProteinID: ACS62031
UniProt: C6BE71
Position
1:761866..762651
AA seq 261 aa
MNTMMKQRAYGAMRRAVLLATLVAGGALTMAGPAAAGVFDDDEARRAIIDMRDKFNNFQS
TAAQRIDQNSKNLIDAQNQIETLKSEVARLRGQNEVLQNSVDTLTKQQKDYYADLDARLK
KFEPQQATVDGREGMVQPNEKPEYDAALKAFQGGDFKGAGNQFSAFVKKYPQSPYLPLAQ
FWLGNALYAQRDYKGSSYVLENMARSNPQHPKAPDALLQVATNQGESGQKAAARKTLESV
VSQYPGTEQAKTAQSRLKSMR
NT seq 786 nt   +upstreamnt  +downstreamnt
atgaatacgatgatgaaacagcgcgcttatggggccatgcgtcgggccgtcctgctggcg
acgctcgtcgcgggtggcgccctcaccatggccggcccggcggcagcgggggtgtttgac
gacgatgaggcgcgccgcgccatcatcgacatgcgcgacaagttcaacaacttccagtcg
acggctgcccagcgcatcgatcagaacagcaagaacctgatcgacgcgcaaaaccagatc
gagacactcaaatcggaagtggcgcgcctgcgcgggcagaacgaagtcctgcagaacagc
gtcgatacgttgaccaagcagcaaaaggattactacgccgacctcgatgcgcgcctgaag
aagttcgagccgcagcaagccacggtggatggccgcgaaggcatggtccagccgaacgag
aagccggaatacgacgctgcgctcaaggcgttccagggcggggacttcaagggcgcaggc
aatcagttctcggcgttcgtgaagaagtatccccaaagcccgtatctgccgctcgcgcag
ttctggctaggcaacgcgctctatgcgcagcgcgactacaagggctcgagctacgtgctc
gagaacatggcgcgcagcaacccgcagcatccgaaggcgcccgatgcgctgctgcaggtg
gcgaccaaccagggcgagtctggccagaaggcggccgcacgcaagacgctggaatcggtg
gtctctcagtatcccggcaccgagcaggcaaagacggcgcaaagccgtctgaagtcgatg
cgctga

DBGET integrated database retrieval system