KEGG   Ralstonia pickettii 12D: Rpic12D_0759
Entry
Rpic12D_0759      CDS       T00925                                 

Definition
(GenBank) transcriptional regulator, LacI family
  KO
K02525  LacI family transcriptional regulator, kdg operon repressor
Organism
rpf  Ralstonia pickettii 12D
Brite
KEGG Orthology (KO) [BR:rpf00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rpf03000]
    Rpic12D_0759
Transcription factors [BR:rpf03000]
 Prokaryotic type
  Helix-turn-helix
   LacI family
    Rpic12D_0759
SSDB
Motif
Pfam: Peripla_BP_3 LacI Peripla_BP_1 Peripla_BP_4 HTH_3 HTH_IclR HTH_31 HTH_Tnp_ISL3 CbiJ HTH_19
Other DBs
NCBI-ProteinID: ACS62060
UniProt: C6BEA0
Position
1:789996..791060
AA seq 354 aa
MTDFPSSSSRPATITDVAREAGTGKTSVSRYLNGETQVLSEDLRQRIEAAIKRLNYRPNQ
MARGLKRGRNRLLGMLVADLTNPYTIEVLQGVEAACHALGYMPLICHAANEIEMERRFVQ
LLTTYRVEGLIVNALGAEEAVLRPLRGGGIPAVLVDRTVEGFDADLVGLDNRGAVGLGVQ
HLLDHGFDAIQFIVQPFEQVSSRRERELAFREAMAAQGWPAEPTVVLDPNEPASTERALA
EIDARIDAVYQRGEKRLALFVANAPVALVVARHLRTQFGPAWQERAALLSIDDPEWAELI
GTTTIRQPTYDIGYKAVEFVHERIEGVSGAARVVLLPGTLVERASTVHSTQAAS
NT seq 1065 nt   +upstreamnt  +downstreamnt
gtgactgatttcccatcctcttcctcgcgccctgcgaccatcaccgacgtggcccgcgaa
gcgggaaccggcaagaccagtgtgtcccgctacctgaatggcgagacccaagtcctttcc
gaagatttgcgacagcgcatcgaagccgccattaagcggttgaactaccggcccaaccag
atggcgcgcggtctcaagcgcggccgcaatcgcctgctcggcatgttggtggccgacctg
accaatccttacacaatcgaagtcctgcagggcgtcgaggcagcctgccacgcgctgggc
tacatgccgctcatctgccacgccgcaaacgagatcgagatggagcgccgcttcgtccag
ctgctgacgacgtatcgggttgaaggcctgatcgtcaatgcgctcggcgcggaagaggcc
gtgttgcggccgctgcggggtggcggcattccggctgtgctggtggatcgcacggtagaa
gggttcgacgccgacctcgtggggctcgataaccgcggcgccgtcgggctgggcgtgcaa
catctgctggatcacggtttcgatgccatccagttcatcgtgcagccgtttgagcaggtc
agttcccggcgtgaacgcgaacttgcctttcgagaggcgatggcagcgcaagggtggcca
gcggagccgaccgtggtgctcgacccgaacgagccggcctcaactgagcgtgcgctggcc
gagatcgatgcacgcatcgatgcggtgtatcagcgaggcgaaaaacgactcgcgctgttt
gttgccaacgcgccggtcgcgctcgttgttgcgcgacatctgcgcacgcagtttggccca
gcctggcaggagcgggcggcgctgctgtcgatcgatgatccagaatgggccgagttgatc
ggcaccaccacgatccggcaaccaacgtatgacatcggctacaaggcggtcgaattcgtg
catgaacgcatcgaaggcgtgagcggggctgcccgtgtcgtgttgctgcccggcacgctg
gtcgaacgtgcttcgacggtgcattcgacgcaggccgcgtcatga

DBGET integrated database retrieval system