KEGG   Ralstonia pickettii 12D: Rpic12D_0789
Entry
Rpic12D_0789      CDS       T00925                                 

Definition
(GenBank) glucose-methanol-choline oxidoreductase
  KO
K19813  glucose dehydrogenase [EC:1.1.5.9]
Organism
rpf  Ralstonia pickettii 12D
Pathway
rpf00030  Pentose phosphate pathway
rpf01100  Metabolic pathways
rpf01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rpf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Rpic12D_0789
Enzymes [BR:rpf01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.9  glucose 1-dehydrogenase (FAD, quinone)
     Rpic12D_0789
SSDB
Motif
Pfam: GMC_oxred_C DAO GMC_oxred_N FAD_binding_2 NAD_binding_8 Lycopene_cycl Pyr_redox_2 FAD_oxidored FAD_binding_3 HI0933_like Pyr_redox GIDA ApbA Thi4 K_oxygenase
Other DBs
NCBI-ProteinID: ACS62090
UniProt: C6BEQ3
Position
1:816895..818517
AA seq 540 aa
MAQSEQTRQQADIVVVGSGVAGALVAYELARAGKSVLMLEAGPRLPRWEIVERFRNQADK
MDFMAPYPSTAWAPHPEYGPPNNYLVLKGEHQFNSQYIRAVGGTTWHWAASTWRFLPNDF
KLRSVYGIARDWPIQYQDLERYYGLAEEALGVWGPNDEDLGSPRSQPYPMTPLPLSFNER
TIKEALNAHDASFHVVTEPVARNSRPYDGRPTCCGNNNCMPICPIGAMYNGIVHVEKAEQ
AGARLIENAVVFKLEVGPNKRIVAARYKDSKGAEHRVEGKWFVLAANGIETPKLMLMSTS
QDFPKGVGNSSDMVGRNLMDHPGTGVSFYADRKLWPGRGPQEMTSLIGFRDGPFRATQAG
KKLHLSNISRIEQETQRIFKEGKLIKPADLDARIRDQAARYVQFDSFHEILPLPENRIVP
SATEVDAIGIPRPEITYHIDDYVKRSAVHTREVYATAAQVMGGTNVEFHDDFAPNNHITG
ATIMGADPKDSVVDKDCRTFDHPNLFISSSSTMPTVGTVNVTLTIAALALRIADQLKQEA
NT seq 1623 nt   +upstreamnt  +downstreamnt
atggcccaatctgaacaaactcgccaacaagccgatatcgtggtggtgggctccggcgtg
gccggggcgctggtggcgtacgagctggcgcgcgcgggcaagtcagtgctgatgctcgaa
gccggcccgcgcctgccgcgctgggaaattgtagagcgcttccgcaaccaggccgacaag
atggatttcatggcgccgtatccatcgacggcatgggcgccgcacccggaatacgggcca
cccaacaactacctcgtgctcaagggtgagcatcagttcaactcgcagtacatccgggcg
gtgggtggcacgacctggcactgggccgcatcgacgtggcgcttccttccgaacgatttc
aagctgcgcagcgtgtacggcatcgcgcgcgactggccgatccagtatcaggatctggag
cgctattacggcctggccgaagaggccctcggcgtctggggaccgaacgacgaagacctc
ggctcgccgcgtagccagccttatccgatgacgccgcttccgctctcgttcaatgagcgc
acgatcaaggaagcgctcaatgcgcacgacgcgagcttccacgtggtgaccgaacccgtg
gcgcgcaacagccgcccgtacgacggccgcccgacctgctgcggcaacaacaactgtatg
ccgatctgcccgatcggtgcgatgtacaacggcatcgtgcatgtggagaaagccgagcag
gccggcgcacggctgatcgagaacgccgtggtcttcaagctcgaagtcggccccaacaag
cgcatcgtggcggcgcggtacaaggattcgaaaggcgccgagcaccgcgtggaaggcaag
tggttcgtgctggctgccaacggcatcgaaacgcccaagctgatgctgatgtcgaccagc
caggattttccgaagggcgtgggcaacagctccgacatggtggggcgcaacctgatggac
catcccggcaccggcgtgagcttctatgccgaccgcaagctatggccgggacgcgggccg
caggaaatgacgtcgctgatcggctttcgcgatgggccgtttcgcgccacgcaggctggc
aagaagctgcacctgtcgaacatctcgcgcatcgagcaggaaacgcagcgcatcttcaag
gaaggcaagctcatcaagccggccgacctcgatgcacgcattcgcgaccaggccgcgcgc
tacgtgcagttcgacagctttcacgagatcttgccgctgcccgagaaccgcatcgtgccg
agtgcgacggaagtggacgccatcggcattccacgccccgagatcacgtaccacattgac
gattacgtcaaacgcagcgccgtgcatacgcgggaggtctacgcgacggcagcccaggta
atgggcggcaccaatgtcgaattccacgacgacttcgcacccaacaatcacatcaccggc
gcaaccatcatgggggccgatccgaaagactccgtggtcgacaaggattgccggacgttc
gaccatccgaatctgttcatcagcagcagttccaccatgccgacggtgggcaccgtcaac
gtgacgctgaccatcgcggcactggccctgcggattgccgatcaactgaagcaggaggcg
tga

DBGET integrated database retrieval system