KEGG   Ralstonia pickettii 12D: Rpic12D_0793
Entry
Rpic12D_0793      CDS       T00925                                 

Definition
(GenBank) Thioredoxin domain protein
  KO
K03671  thioredoxin 1
Organism
rpf  Ralstonia pickettii 12D
Brite
KEGG Orthology (KO) [BR:rpf00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:rpf03110]
    Rpic12D_0793
Chaperones and folding catalysts [BR:rpf03110]
 Protein folding catalysts
  Protein disulfide isomerase
   Rpic12D_0793
SSDB
Motif
Pfam: Thioredoxin Thioredoxin_8 OST3_OST6 Thioredoxin_6 HyaE
Other DBs
NCBI-ProteinID: ACS62094
UniProt: C6BEQ7
Position
1:complement(823074..823442)
AA seq 122 aa
MKTVNDASFQSDVIDASQRNPVVVCFAAEWSHPSQSAVASLEQMESSYAGRATFVTMDFD
ENQHTADRYGVSVMPGFVVFADCQPRDGWSGVYADTIREKLDQVIPRSSNTPSDAGDRPQ
RR
NT seq 369 nt   +upstreamnt  +downstreamnt
atgaagaccgtcaacgatgcctcgtttcaatccgatgtgatcgacgcctcgcaacgcaac
ccggtggtggtgtgctttgccgcggagtggagccacccgagccagtccgccgtggccagc
ctcgagcagatggaatcgagctacgccggacgtgccaccttcgtcacgatggacttcgac
gaaaaccagcacaccgccgatcgatacggcgtgtcggtcatgcctggttttgtggtcttt
gctgactgccagccgcgcgatggatggtcgggcgtctatgccgacaccatccgcgagaag
ctggatcaggtcattcctcgatcaagcaatacgccatcagacgccggcgatcgcccgcag
cgccgttga

DBGET integrated database retrieval system