KEGG   Ralstonia pickettii 12D: Rpic12D_0798
Entry
Rpic12D_0798      CDS       T00925                                 

Definition
(GenBank) aankyrin repeat-containing protein
  KO
K06867  uncharacterized protein
Organism
rpf  Ralstonia pickettii 12D
Brite
KEGG Orthology (KO) [BR:rpf00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    Rpic12D_0798
SSDB
Motif
Pfam: Ank_4 Ank_2 Ank_5 Ank_3 Ank DUF3107
Other DBs
NCBI-ProteinID: ACS62099
UniProt: C6BER2
Position
1:complement(827514..828308)
AA seq 264 aa
MLIAPHPALNQLIGVMLGMALAVGDMANAWQEQHLPILHVAASAGAKVAPGATHAADTRP
VRRSDPATRDRDLILAAQAGNTMAIQSLLAEGASLKARDADGRTALIAAVMAHMGAAARL
LIQAGADVNLQDNTQNSAFLLAASQGDAETVRLALSHGANLRATNADGDTALIPAARRGY
VEVVNELVKAGVPPDATNNLGLTALIEAVALGDGSDKYEKTVQVLLDGGADPNLADRGGV
TPMRHARQRGFHGIGALLFKARGH
NT seq 795 nt   +upstreamnt  +downstreamnt
atgctcatcgctccgcatcccgcgctcaaccagctcatcggcgtcatgctggggatggcg
ttggctgtgggcgacatggccaacgcgtggcaggagcagcatctgcccatcctgcatgtg
gcggccagcgccggcgcgaaagtcgcacccggtgcgacccacgccgcggacacccgcccc
gtgcgccgcagcgacccggccacgcgtgaccgcgacctgatccttgccgcacaggccggc
aacacgatggcgatccagtcgttgctggccgaaggcgccagcctcaaggcgcgcgacgcc
gatggccgcaccgcgctcatcgctgccgtcatggcgcacatgggcgcggcagcacgcctg
ctcatccaggccggtgccgacgtcaacctgcaggacaacacgcagaacagcgcctttctg
ctcgctgccagccagggcgatgcggaaacggtgcgcttagccctgtcgcacggcgccaac
ctgcgcgccaccaacgctgacggcgacaccgcgctcatcccggccgcgcgtcgtggctat
gtcgaagtcgtcaatgaactcgtgaaggccggcgttccacccgatgccaccaacaacctg
ggcctgaccgcgctgatcgaagccgtggccctgggcgatggcagcgacaaatacgagaag
accgtgcaagttctgctcgacggcggagcggacccgaacctggccgaccgcggtggcgtc
acgccgatgcggcatgcgcgtcagcgtggtttccacggcatcggcgcgctgctcttcaag
gcgcgcggacattga

DBGET integrated database retrieval system