KEGG   Rickettsia peacockii: RPR_04270
Entry
RPR_04270         CDS       T00907                                 

Definition
(GenBank) type IV secretion system ATPase VirB11
  KO
K03196  type IV secretion system protein VirB11 [EC:7.4.2.8]
Organism
rpk  Rickettsia peacockii
Pathway
rpk03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:rpk00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    RPR_04270
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:rpk02044]
    RPR_04270
Enzymes [BR:rpk01000]
 7. Translocases
  7.4  Catalysing the translocation of amino acids and peptides
   7.4.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.4.2.8  protein-secreting ATPase
     RPR_04270
Secretion system [BR:rpk02044]
 Type IV secretion system
  Conjugal DNA-protein transfer (VirB/D) protein
   RPR_04270
SSDB
Motif
Pfam: T2SSE AAA_28 AAA_7 MoCF_biosynth FtsK_SpoIIIE
Other DBs
NCBI-ProteinID: ACR47543
UniProt: C4K1U3
Position
725740..726744
AA seq 334 aa
MSEEFAALETFLLPFKNLFAEDGINEIMVNKPGEVWVEKKGDIYSKQIPKLDSEHLLALG
SLVAQSTEQMISEEKPLLSATLPNGYRIQIVFPPACEIGQIIYAIRKPSGMNLTLDEYAK
MGAFDDTATESLVDEDAVILNNFLAEKKIKEFIRHAVVSKQNIIISGGTSTGKTTFTNAA
LTEIPAIERLITVEDAREVVLSHHPNRVHLLASKGGQGRANVTTQDLIEACLRLRPDRII
VGELRGKEAFSFLRAINTGHPGSISTLHADSPAMAIEQLKLMVMQADLGMPPEEVKKYIL
TVVDIVVQLKRGSGGKRYVSEVYYKKNKNAEGMV
NT seq 1005 nt   +upstreamnt  +downstreamnt
atgagtgaagaatttgcagccttagagacgtttttactgccttttaaaaatttatttgct
gaagacggtattaacgaaattatggttaataagcccggagaagtatgggttgaaaaaaaa
ggtgatatatattctaagcaaataccgaaactggatagcgaacatctacttgcattaggg
agtttagtcgctcaatctaccgaacagatgatttcagaagaaaaaccgcttctttcggca
actttgccgaatggctaccgtattcaaatagtatttcctcctgcttgtgagataggacaa
atcatttatgctataagaaagcctagcggtatgaatctaactttagatgaatatgctaaa
atgggggcatttgatgatactgcaacagagagtttagtagatgaagatgcagtaatttta
aataatttcttagctgaaaaaaagattaaagaatttattagacatgcagttgtttcaaag
caaaatatcataattagcggcggtacttcaaccggtaaaactacttttactaatgcggca
ctcactgaaatacctgcaatagaaagattaattactgtagaagatgctcgtgaggttgtg
ctatcacaccatcctaacagagtgcatttactggcttccaaaggaggacaggggcgtgca
aatgttactactcaagatttaatagaggcctgtttgcgtttaagaccagataggattata
gtaggtgagcttcgaggtaaggaagcttttagttttttgcgtgctattaatacaggtcat
cccggttcaatatcaacactgcatgctgatagtcccgctatggctattgagcagttaaag
cttatggttatgcaagcagatcttggtatgccgcctgaagaagtaaagaagtatatttta
accgttgtagatatcgttgtgcagttaaaacgcggtagcggcgggaaaagatatgtttcg
gaagtatattataagaagaacaagaacgctgaggggatggtttaa

DBGET integrated database retrieval system