KEGG   Rickettsia prowazekii Madrid E: RP205Help
Entry
RP205             CDS       T00018                                 

Definition
(RefSeq) multidrug resistance transporter ATM1
  KO
K06147  ATP-binding cassette, subfamily B, bacterial
Organism
rpr  Rickettsia prowazekii Madrid E
Brite
KEGG Orthology (KO) [BR:rpr00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rpr02000]
    RP205
Transporters [BR:rpr02000]
 ABC transporters, eukaryotic type
  ABCB (MDR/TAP) subfamily
   ABCB-BAC subgroup
    RP205
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_membrane ABC_tran SMC_N RsgA_GTPase Zeta_toxin AAA_22 DUF87 DUF4845 AAA_29 AAA_18 AAA_24 Phage_holin_3_1 AAA_16 ATP-synt_ab Beta-lactamase2
Motif
Other DBs
NCBI-GeneID: 883922
NCBI-ProteinID: NP_220593
UniProt: Q9ZDW0
Position
247683..249512
Genome map
AA seq 609 aa AA seqDB search
MIKQRGDNFMSKNNNHKNAFYLLLTYLWSKDFDIRLRIVTSLICLVIAKVINIFVPIVYK
YIIDGLNQNLSLSVLIGVIIGYGGTKILAQIFSELRNIIFSKVGCQATRLVALNVFKHMH
NLSMRFHITRKTGGLSRSIERGTKGIEAVLRYSLFNIFPTSLEIILVIGILWYFHGIWFA
VTLLITMIVYVCYTLLISTWRISFAREMNQSDNTANNRAIDSLLNFETVKYFNNEEYEAI
KFNDALQAYEKSATKITNSLSILNIGQDVIISLGLVSLMILSVNAINQNKMMVGDLIMVN
AYLFQLSIPLSILGFAYREIKNALVNMEDMFKLLDIPAEIQDSVDAKELIISKCKVSFNN
VSFAYNKERTILHNITFTIESGKTIAVVGSSGAGKSTISRLLFRFYDINSGSIIIDNQDI
REVKQGSLRKSIGIVPQDTVLFNDTIYYNIAYGNNAASYDEVIAASKNAHIHEFISVLPE
GYATQVGERGLKLSGGEKQRIAIARTILKNPSIYVFDEATSSLDTKTEKLIQASLKEISA
NHTTLIIAHRLSTIVDADEIIVLDNGYIVERGNHKTLLKNQGYYAELWYKQQEECNQDTQ
NCKQIICDA
NT seq 1830 nt NT seq  +upstreamnt  +downstreamnt
gtgattaagcaacggggtgacaattttatgtctaaaaataacaatcacaaaaatgcattt
tatctacttcttacatatttatggtcgaaggactttgatatcagattacgtattgttacg
tctcttatttgtttagttatagctaaagtaataaatatttttgttccaattgtttataaa
tatataatagacggactaaatcaaaatttatctctttcagttcttattggcgttattatt
ggatatggtgggacaaaaatacttgcccaaattttcagtgaattacgaaatataattttt
tcaaaagttggatgtcaagcaacacgcttagtcgctttaaatgtctttaaacacatgcat
aatttaagtatgcgcttccatattactagaaaaacaggtggtttaagtaggtcaatagag
cgtggtactaaaggtattgaagcagtgctacggtattcattatttaatattttcccgaca
agcttagaaattatattggtcatcggaatattatggtattttcatggtatatggtttgca
gtaactctcttaataacaatgatagtttatgtgtgttatactttattaatcagtacttgg
cgtatttcatttgcaagggaaatgaaccaaagcgataacactgcaaataatagagcgatc
gatagtttgttgaattttgaaacagttaaatattttaataatgaagaatatgaggcaata
aagtttaatgatgctttacaagcttatgaaaaatcagctactaaaattactaacagccta
tcaattttgaatattggacaggatgttataatatccttaggtcttgtttctttaatgata
ctttcagtaaatgctattaatcaaaataaaatgatggtcggcgatttaataatggttaat
gcttatctatttcagttatcaatcccactttcaatacttggttttgcttatagagaaatt
aaaaatgctctagtgaatatggaagatatgtttaagttacttgatataccggcagaaata
caagattcggtagatgctaaggagttaattatctcaaaatgtaaagtcagtttcaataat
gttagctttgcttataataaggaacgtactattttgcataatataacttttacaattgag
agcggtaaaacaatagcagttgtaggtagcagcggtgccggtaaatcaacgatatcacga
ttgctttttaggttttacgatattaatagtggtagtattattatagataatcaagatata
agagaagttaagcaaggctcgcttcgtaaatctattgggattgttccacaagatacggta
ttgtttaatgatacaatatattataacatcgcatacggtaataatgcagctagttacgat
gaagttatcgcagcttcaaaaaatgctcatattcatgagtttattagcgtactacctgaa
ggttatgcgacacaggtaggtgaaagaggtttaaaactttcaggtggtgaaaaacaacgt
attgcaattgcaagaactatcttaaaaaatccatcaatatatgtttttgatgaagcgaca
agttcacttgatactaaaaccgaaaagctaattcaagcaagtcttaaagagatttcagct
aaccatactactcttatcatcgctcatagattatcgactattgttgatgcagatgagatt
atagttttagataatggctatatagttgaacgaggaaatcataaaacattactaaaaaac
caaggctattacgctgaattatggtataaacagcaggaggaatgtaaccaagatacacag
aattgtaagcaaataatatgtgatgcctaa

DBGET integrated database retrieval system