KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104654224
Entry
104654224         CDS       T03989                                 

Gene name
AHRR
Definition
(RefSeq) aryl hydrocarbon receptor repressor
  KO
K09094  aryl hydrocarbon receptor repressor
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Brite
KEGG Orthology (KO) [BR:rro00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rro03000]
    104654224 (AHRR)
Transcription factors [BR:rro03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    104654224 (AHRR)
SSDB
Motif
Pfam: PAS HLH PAS_4 PAS_3 PAS_9
Other DBs
NCBI-GeneID: 104654224
NCBI-ProteinID: XP_030782936
Position
3
AA seq 697 aa
MIPPGECTYAGRKRRRPLQKQRPAMGAEKSNPSKRHRDRLNAELDHLASLLPFPPDIISK
LDKLSVLRLSVSYLRVKSFFQVVQEQSSRQPAAGAPSPRDSRPLAGSAVLEGRLLLESLN
GFALVVSAEGTVFYASATIVDYLGFHQTDVMHQNIYDYIHVDDRQDFCRQLHWAMDPPQV
VFGQPPPLETGDDAILGRLLRAQEWGAGAPTEYSAFLTRCFICRVRCLLDSTSGFLTMQF
QGKLKFLFGQKKKAPSGAVLPPRLSLFCIVAPVLLPSTAEMKMRSALLRAKPRADTTATT
DAKVKANSSLCESELHGKPNYSAGRSGRESGVLVLREHTDAGRWAQVPTRAPCLCLRGGP
DLVLDPKGCSGDREEEQHRMLSRASGVTGHRETPGPTKPLPWTAGRHSEDGARLRLQPSK
SDPPGLRPTPRGSCLPYSCVQGTLRNSPISHPPSPSPSAYSSRTSRPVRDVGEDQVHPPL
CHFPQGSLQHRLPQPGAQRCATRGYPMEDVKLQGVPMPPGDLCGPTLLLDVPIKMEKDSG
SEDAADGCVPSQVWLGASDRSHPATFPTRMHLKTEPDSRQQVYLSHLGHGMRGTQPHGRA
TVGRSRELTSFHPAHCASLEPVHGLSQPEPSHQLCARGRGEQSCACRAAEAAPVVKREPL
DSPQWATHSQGVVPGMFPKSALATLVPPQASECTFLP
NT seq 2094 nt   +upstreamnt  +downstreamnt
atgatcccgcccggggagtgcacgtacgcgggccggaagcggaggaggcccctgcagaaa
cagaggcccgccatgggggcagagaagtccaacccctccaagcggcaccgggaccgcctc
aacgccgagttggaccacctggccagcctgctgccgttcccacctgacatcatctccaag
ctggacaagctttctgtcctgcgtctcagtgtcagttacctccgggtgaagagcttcttc
caagtcgtgcaggagcagagctcacggcagccggcggccggtgccccctcgcccagagac
agtcgtcctcttgcagggtctgccgtgctggagggaaggctgctgctggagtctcttaat
ggctttgctctggtcgtgagtgcagaagggacagtattttatgcgtcagcaacgatcgtg
gactatctgggcttccatcagacagacgtgatgcaccagaacatttacgactacatccac
gtggacgaccgccaggacttctgccggcagctccactgggccatggaccctccccaggtg
gtgtttgggcagcccccgcccttggagacaggagatgacgccatcctggggaggctgctc
agggcccaggagtggggcgcaggcgcgcccaccgagtactcagccttcctgacccgctgc
ttcatctgccgtgtgcgctgcctgctggacagcacctcgggcttcctgacgatgcagttt
caaggaaaactgaaattcctgtttggacagaagaagaaggcgccgtccggagccgtgctc
ccgccgcgactgtcgctgttctgcattgtggcacccgttctcctcccctccacagcggag
atgaaaatgaggagtgcgcttctgagggcaaagcccagggcagacaccacggccaccaca
gatgcaaaagtaaaagccaacagcagcctgtgtgaatcggaactgcatggaaaacccaat
tactcagcaggaaggagcggcagagaaagcggcgttttggtgctcagggaacacactgac
gctggccgatgggcacaggttcccaccagggccccgtgcctgtgcctccggggcggcccc
gaccttgtcctcgaccccaaggggtgctcaggggacagggaggaggagcagcacaggatg
ctgagcagggcctccggagtgacagggcacagggagactccaggacccacgaagcccctg
ccctggacagcgggaaggcacagtgaggatggcgccaggctgaggctgcagcccagcaag
agtgacccacccggcctgcgccccacgccccgcggctcctgcctgccctattcgtgtgtc
cagggcactttgaggaactcgcccatctctcacccgccgagcccatcccccagtgcctac
tccagccggaccagcagacctgtgcgggatgtcggtgaggaccaggtgcaccctcccctc
tgccactttccccaggggagcctgcagcaccggctccctcagcctggagctcagcgttgt
gccacgaggggctatcccatggaggacgtgaagctgcagggtgtgccgatgcctccaggg
gacctgtgcggtccgacgctgctgctagatgtgcccatcaagatggagaaggactctggg
tctgaggatgctgcagacggctgtgtgcccagccaggtgtggctgggggccagtgacagg
agccatccagccaccttccctaccaggatgcacctgaaaacagagcctgactctcggcaa
caggtgtacctctcgcacctggggcatggcatgcgggggactcagcctcatggcagggcc
actgttggacgcagcagggagctgacctctttccaccccgcacactgtgcctccctggag
cccgtgcatggcctttcccagccagagccttcccaccagctctgtgcacggggccgaggt
gaacagtcctgcgcctgcagagctgctgaggccgcccctgtggtcaagcgggagcccctg
gattcgccccagtgggcgactcacagccagggagtggtgcctgggatgtttcccaaaagt
gccttggcgacgctggtcccaccccaagcttcagagtgcacattcctgccgtag

DBGET integrated database retrieval system