KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104661335
Entry
104661335         CDS       T03989                                 

Gene name
ANKRD53
Definition
(RefSeq) ankyrin repeat domain-containing protein 53 isoform X1
  KO
K21441  ankyrin repeat domain-containing protein 53
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Brite
KEGG Orthology (KO) [BR:rro00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rro03036]
    104661335 (ANKRD53)
Chromosome and associated proteins [BR:rro03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Spindle formation proteins
    104661335 (ANKRD53)
SSDB
Motif
Pfam: Ank_2 Ank Ank_5 Ank_4 Ank_3
Other DBs
NCBI-GeneID: 104661335
NCBI-ProteinID: XP_010360217
UniProt: A0A2K6P8H2
Position
17
AA seq 530 aa
MASAGSTARRAGSGSWHSEREEGRGARPQPAPRGSMQRANKVSLKATWTDAESKQPSQPL
PDLADHLGAQATALATPHRPASLTAPHADPSPSKESDQTTIDQTAIWSYYQLFAAAVGNV
EWLRFCLNQSLREIPTDYKGFTAIHFAAQRGKLACLQVLVEEYKFPVNLLTNNSQTPLHL
VIHRDNTTVALPCIYYLLEKGAALNAQTCNGSTPLHLAVCEGLLDCVKVLVQSGANVHAQ
DAMGYKPIDFCKIWNHRACARFLKDAMWKKDKKDFAREMRKMKTFKSQLALMEYNYLIEY
QKEHKILREAAIRKWLQGKLHPGHSLVSNTKQARATTISKTPEQQGSQLSRSFHPSVEAR
LQCISQPTEMPKPIYRKPTIKRPTMWNVSNNPARPPTTRISHSQGIRLGVHPDPSPEHDF
SSFLEVRPDGHGGARLHTVDGHWVAPVPRLPFEVLLRMLYPRVWPYRMKVPQGFYPITMR
EVPRKRHLGEDTFWTDTLAMNLRDTFDEAFLAAVRSHQGLPALPSPQINP
NT seq 1593 nt   +upstreamnt  +downstreamnt
atggcctccgcgggcagcaccgctcggcgggcgggctcaggaagctggcactcagaaagg
gaagaagggagaggtgctcggccgcagccagctccacgtggctccatgcagcgggcgaac
aaagtctccttgaaggccacctggactgatgcggagtccaagcagcccagccagcccctg
cctgacctcgccgaccacctcggtgcgcaggcgactgccctcgccacgccacaccgccct
gcctcgctcaccgcgccccacgctgatcccagccccagcaaggagtccgaccagaccacg
atcgaccagacggcgatctggagctactaccagctgttcgcggcggctgtgggcaacgtg
gaatggctgcggttctgtctgaaccagagcctcagggaaatccccaccgactacaagggc
ttcactgccatccacttcgcagcccaacggggcaagcttgcatgcctgcaggtcctggta
gaggagtacaagtttcccgtgaacctgctgaccaacaatagccagacccccctgcacctc
gtcatccacagggacaacaccaccgtggccctcccctgcatctactacctgctggagaaa
ggcgcagccctcaatgctcagacatgcaacggctccacgcccctgcacctggcagtctgt
gagggcctgctggactgtgtgaaggtcctggtacagagtggtgccaacgtccacgcccaa
gatgccatgggctacaaacccattgacttctgcaaaatatggaaccaccgtgcctgtgcc
cggttcttgaaggatgccatgtggaaaaaggacaagaaggactttgcccgtgagatgaga
aaaatgaagacgttcaagagccagctggccctcatggagtacaactacctgattgagtat
caaaaagagcacaaaattctcagagaagctgctatcagaaagtggctacagggcaagctg
cacccaggccactctctggtctctaataccaagcaagcccgggccaccaccatctccaag
actccagagcaacagggatcgcagctttccaggagcttccacccctctgtggaggcgcgc
ctgcaatgcatttcacagcccacggagatgcccaagcccatctacaggaagcccacgatc
aagcggcccacgatgtggaacgttagcaacaaccctgccagaccccccaccacccggatc
agccactcacaaggcatccgcctgggcgtgcatccagaccccagcccggagcacgacttc
agcagcttcctggaggtgaggccagacgggcacggcggtgcacggctgcacacagtggat
ggccactgggtggcgccagtgccgcggctgccttttgaggtgctgctccgcatgctgtac
ccacgtgtgtggccctacagaatgaaggtgccccagggcttttaccccatcaccatgagg
gaagtgcccaggaagcggcacctgggtgaggacaccttctggactgacactctggccatg
aacctgcgtgacacatttgatgaagccttcctggcagctgtgcgatcccatcaaggactc
cctgccctgccctccccacaaatcaacccataa

DBGET integrated database retrieval system