KEGG   Rhodospirillum rubrum ATCC 11170: Rru_A0217Help
Entry
Rru_A0217         CDS       T00310                                 

Definition
(RefSeq) citrate lyase
  KO
K08691  malyl-CoA/(S)-citramalyl-CoA lyase [EC:4.1.3.24 4.1.3.25]
Organism
rru  Rhodospirillum rubrum ATCC 11170
Pathway
rru00630  Glyoxylate and dicarboxylate metabolism
rru00660  C5-Branched dibasic acid metabolism
rru00680  Methane metabolism
rru01100  Metabolic pathways
rru01120  Microbial metabolism in diverse environments
rru01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:rru00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Rru_A0217
   00660 C5-Branched dibasic acid metabolism
    Rru_A0217
  09102 Energy metabolism
   00680 Methane metabolism
    Rru_A0217
Enzymes [BR:rru01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.24  malyl-CoA lyase
     Rru_A0217
    4.1.3.25  (S)-citramalyl-CoA lyase
     Rru_A0217
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HpcH_HpaI C-C_Bond_Lyase Malate_synthase DUF3577
Motif
Other DBs
NCBI-GeneID: 3834329
NCBI-ProteinID: YP_425309
UniProt: Q2RXX3
Position
268873..269850
Genome map
AA seq 325 aa AA seqDB search
MSFTLVDQAPARLNRSEQAVPGSNTKFLEKAAKGDADVVFLDLEDAVAPSEKEQARKNII
AALNDLDWSGKTVSLRINGLDTHYMYRDVIDVLEQAPGKLDLIMIPKAGTAADVYALDML
VTQIETATKVDKRIGFELIIETALGMRNIHEIAGASPRNESLHFGVADYAASTKARTTAI
GGPNADYGVLTDPLDDGQRAYHWGDMWHYAIARMVVAARAHGLRPVDGPFGDIGDHDGYR
AQALRAAVLGCEGKWAIHPSQVTLANEVFSPSDKEVAHAQAILDAMEQAGKEGKGAVTLN
GRLIDIASIKQAQVMVDKARQVRAG
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgagcttcactcttgtcgatcaggcgccggcccgtctcaaccgttcggaacaggccgtg
ccgggctccaacaccaaattcctggaaaaggccgccaagggcgatgccgacgtggtgttc
ctcgatctggaggacgcggtggcgccctcggaaaaggaacaggcgcgcaagaacatcatc
gccgcgctcaatgacctggactggtcgggcaagaccgtgtcgctgcgcatcaacggcctt
gatacccattacatgtaccgcgatgtcatcgacgtgctggaacaggcgccgggcaagctt
gatctgatcatgatccccaaggccggcacggcggccgacgtctatgcccttgatatgctg
gtcacccagatcgaaacggcgaccaaggtcgacaagcgcatcggcttcgagctgatcatc
gaaaccgccttgggcatgcgcaatatccacgagatcgccggggccagcccgcgcaacgag
tcgttgcatttcggcgtggccgattacgccgcctcgaccaaggcgcggacgacggcgatc
ggcggccccaacgccgattacggcgtgctgaccgatccgcttgacgatggccagcgggcc
tatcattggggggacatgtggcattacgccatcgcccgcatggtggtcgccgcccgcgcc
cacggcctgcgcccggttgacggcccctttggcgatatcggcgatcacgacggctatcgc
gcccaggccttgcgcgccgccgtgctgggctgcgagggcaaatgggcgatccatcccagt
caggtgacgttggccaacgaggtgttcagcccctcggacaaggaggtcgcccatgcccag
gccattcttgacgccatggaacaggcgggcaaagagggcaagggggcggttactctcaac
ggccggctgatcgatatcgcctcgatcaagcaggcccaggtgatggtcgacaaggcccgt
caggtccgcgccggctaa

DBGET integrated database retrieval system