KEGG   Runella slithyformis: Runsl_5280
Entry
Runsl_5280        CDS       T01553                                 

Definition
(GenBank) biotin/lipoyl attachment domain-containing protein
Organism
rsi  Runella slithyformis
SSDB
Motif
Pfam: HlyD_D23 Biotin_lipoyl_2 HlyD_3 Biotin_lipoyl PTS_EIIA_1 Spc29 ChlamPMP_M DUF812 OEP CC2-LZ DUF4407 XhlA HrpB7 UPF0242 Sec8_exocyst
Other DBs
NCBI-ProteinID: AEI51579
Position
6138522..6139466
AA seq 314 aa
MRYLIGGIAVLIGMSGCGDTDKTKEAKAGRDTVQVAPTKNEIVGVGRIEPEDGVIELTAG
ATGRILEILVKDNQTVEKGMPLLRIDIALENAQVQQAQSKLSTQQAAVSVNQSTLEGLRV
NLENARETYQRNLDLYKGNAQTKQVLDDSKASVDKLTKDVETAEASIRQSQSRMGELQAD
LRYYRTVVNNKRVEALMAGKILKMTVKTGDYINNDTKIAEFAPSGGLYAKTEVDELYAER
VNVGQKAYIVSQTTGDTLATGMVSFAADYLKQKSLFKDQATEQEDRRVREVFIRLDTGKM
PLIGSRVDCVILLK
NT seq 945 nt   +upstreamnt  +downstreamnt
atgagatacctgatcggaggaatagccgtcctgataggaatgagcggctgcggtgatacc
gacaaaacaaaagaggcaaaagcaggcagggatacggtgcaggtggcaccgaccaaaaac
gaaatcgttggggttgggcggatagagccggaagacggcgtcatcgagctgaccgccggg
gccacggggcggatactggaaatccttgtgaaagataatcaaacggttgaaaaagggatg
cctttactccgcattgacattgcccttgaaaacgctcaggtacaacaggcccaaagcaag
ctgtccactcagcaggcggctgtttcggtcaatcagtctacgctggaagggcttcgggtc
aatctggagaatgcccgggagacctaccaaagaaacttggatctttacaaaggaaacgcc
caaacgaaacaggtcttggacgacagcaaggcgagtgttgataaactcacgaaggatgtc
gaaacggcggaggcctctattcgtcagtcacaaagccggatgggcgagttgcaggcggat
cttcggtactaccgcacggtcgtaaataacaaaagagtggaagccctgatggcaggcaaa
attcttaaaatgacggtcaagacgggcgattatatcaacaacgataccaaaatcgcggaa
tttgcgccaagcggagggctgtatgccaaaacggaagtggatgaactttacgccgaacgg
gttaatgtaggtcaaaaggcgtacatcgtctcgcaaacaaccggcgatacgctggccacc
ggaatggtaagctttgcggctgattacctcaaacagaaatcgctatttaaagaccaggcg
accgagcaggaggaccgtcgggtacgggaagtgttcatacggcttgatacgggaaaaatg
ccgctcatcggcagcagggtagattgcgtgattttgctgaaataa

DBGET integrated database retrieval system