KEGG   Runella slithyformis: Runsl_5282
Entry
Runsl_5282        CDS       T01553                                 

Definition
(GenBank) outer membrane efflux protein
  KO
K12340  outer membrane protein
Organism
rsi  Runella slithyformis
Pathway
rsi01501  beta-Lactam resistance
rsi01503  Cationic antimicrobial peptide (CAMP) resistance
rsi02020  Two-component system
rsi03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:rsi00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Runsl_5282
  09132 Signal transduction
   02020 Two-component system
    Runsl_5282
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    Runsl_5282
   01503 Cationic antimicrobial peptide (CAMP) resistance
    Runsl_5282
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rsi02000]
    Runsl_5282
   02044 Secretion system [BR:rsi02044]
    Runsl_5282
   01504 Antimicrobial resistance genes [BR:rsi01504]
    Runsl_5282
Transporters [BR:rsi02000]
 Other transporters
  Pores ion channels [TC:1]
   Runsl_5282
Secretion system [BR:rsi02044]
 Type I secretion system
  alpha-Hemolysin/cyclolysin transporter
   Runsl_5282
  RTX toxin transporter
   Runsl_5282
  RaxAB-RaxC type I secretion system protein
   Runsl_5282
  AlgE-type Mannuronan C-5-Epimerase transporter
   Runsl_5282
Antimicrobial resistance genes [BR:rsi01504]
 Gene sets
  Multipdrug resistance modules
   Multidrug resistance, efflux pump AcrEF-TolC [MD:M00696]
    Runsl_5282
   Multidrug resistance, efflux pump MdtEF-TolC [MD:M00697]
    Runsl_5282
SSDB
Motif
Pfam: OEP YbaB_DNA_bd
Other DBs
NCBI-ProteinID: AEI51581
Position
6140627..6141952
AA seq 441 aa
MNAEKSMKKILIISGLLSMVLTGYAQKMTLEESIQTALANRWEIKNAQLEIQVAQGENDQ
LKAKWLPQVKGAADARWNTQLQTSVFKNAPFANGQDVRLVLGVPFNTTVGINAEQKIVDA
TAKYDRQLNAVNVDSRKIAQEKTKTDLRQAVTEAYYAALFNAEKVQLAQRALERAQAYQL
AGRTKFEKGTLLLNDLDRLRLDVNNAQTALRKAKSDQLLSLENLTYQMGLAAGSPVQLAD
SLPSLYEKTMVMVSQESLERRPEILQEKNALKINELNEKKQSSRWLPLVSAYGSYTALQL
NDVFNPFTAGTWFPYSFLGVKLEIPIFDGRQASLQKRNYAIQASINRNNLKQLEADFAYE
IRSIATTLAQEKDNVNDTRANLELARQILETDRFRYEKGVLLLSDLKNSEYSLQNAETNY
LTSVYNFLLASLRYQKATGGL
NT seq 1326 nt   +upstreamnt  +downstreamnt
atgaacgcagaaaaaagcatgaaaaagatattgataattagtgggttactaagcatggta
ttgaccggctatgcccaaaagatgacgttggaagaaagcatccaaacggctttggcaaac
cgttgggagatcaaaaacgcacagctggaaatacaggtggcgcagggcgaaaatgaccaa
ttgaaagccaaatggctgccgcaggtcaaaggcgcggccgatgcgcgttggaatacgcaa
ctgcaaacgtcggtttttaagaatgctccttttgccaacgggcaggacgttcggctggtg
ttgggggttccctttaatacgaccgtgggaatcaatgccgaacaaaagattgtggacgct
accgccaagtacgaccgtcagttgaatgccgtgaatgtggatagccgaaaaatcgctcaa
gagaagacaaaaactgatctgcgtcaagccgtcacggaggcgtattatgccgcgttgttt
aatgcggagaaagtacaattggcgcagcgtgcgctggagcgtgcgcaggcgtaccaactg
gccggacgcacgaaatttgaaaaagggactttgttactcaatgatctggaccggctgcgt
ctggacgtcaataatgcccaaacggctcttcgaaaggctaaaagcgatcagttgttgagt
ttggaaaacctgacctatcaaatgggccttgctgccggaagccccgtgcagttggctgac
tcgctcccgtcattgtatgaaaaaacgatggtgatggtttctcaggaaagtcttgaacgt
cgacccgaaattttgcaggaaaaaaatgcgctgaaaataaatgaactcaatgaaaaaaag
caaagcagccgttggctgccgctggtctctgcttacgggagctatactgccctgcaactg
aacgatgtcttcaatcctttcacggccggcacgtggtttccttacagttttttgggggtc
aaactggagattccgatttttgacggccggcaggcaagccttcagaagcgtaactatgcc
attcaggcctccatcaaccgcaacaacctcaaacagttggaagccgattttgcctacgaa
atccgttccatagccacgactttagcgcaggaaaaagacaacgtaaacgatacccgcgcc
aaccttgagctggcccgacaaattctggaaaccgaccgatttcggtacgaaaagggagtg
cttctgctctctgatctgaaaaattcagagtacagccttcagaacgccgaaaccaattat
ctcacaagcgtctataattttctgctggcctcccttcggtatcaaaaagcgacggggggg
ctttga

DBGET integrated database retrieval system