KEGG   Ralstonia solanacearum GMI1000: RSc1014
Entry
RSc1014           CDS       T00071                                 
Name
(GenBank) probable transcriptional regulatory dna-binding repressor transcription regulator protein
  KO
K02529  LacI family transcriptional regulator
Organism
rso  Ralstonia solanacearum GMI1000
Brite
KEGG Orthology (KO) [BR:rso00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rso03000]
    RSc1014
Transcription factors [BR:rso03000]
 Prokaryotic type
  Helix-turn-helix
   LacI family
    RSc1014
SSDB
Motif
Pfam: Peripla_BP_3 Peripla_BP_1 Peripla_BP_4 LacI HTH_3 PucR DUF3562
Other DBs
NCBI-ProteinID: CAD14716
UniProt: Q8Y0M9
Position
complement(1067248..1068291)
AA seq 347 aa
MATIKDVAALAGVSFTTVSHVINNTRPVNSETRKRVEEAIRATRYVPSAVARSLKHRTTR
TIGVLVPTATNPYFAELARGIEDVCAAAGYSVILCNSDDDPRKQRDYLRVLMEKRVDGLI
VSSAGPDNALLDALGESALPVVMVDRPTEGILADQVQIDHEEGAYLATRHLLELGHRRIA
CISGPSTLSVTAGRLAGFHRALREAGVPEHAARVAEGDFTSPGGYRAARELLTTGETPTA
IFASNDLMGIGALRAAAELGIAVPKELSIIGFDDIELSRYVYPALSTVGQSIRQLGETTA
STLLEHLTDHAARHHHEIPDAPRRIVLPPRLSLRESTAEPARPARAA
NT seq 1044 nt   +upstreamnt  +downstreamnt
atggccactatcaaggacgttgccgcattagccggggtgtcattcaccaccgtctcgcat
gtcatcaacaacacacggccggtcaactcggaaacgcgcaagcgcgtggaagaggccatc
cgcgccacgcgctatgtacccagcgccgtagcacgctcgctcaagcaccgcaccacgcgc
accatcggcgtgctggtgccgaccgccaccaacccctacttcgccgaactggcgcgcggc
atcgaagacgtgtgcgccgcggccggctacagcgtcatcctgtgcaactccgatgacgat
ccccgcaagcagcgcgactacctgcgcgtgctgatggagaagcgcgtcgacggcctcatc
gtcagcagcgccggaccggacaacgcgctgctcgatgcactgggcgaatccgcgctgccc
gtggtgatggtggaccgtcccaccgagggcatcctggccgaccaggtgcagatcgaccat
gaggaaggcgcctacctggcgacccggcatctgctcgagctcgggcaccgccgcattgcc
tgcatcagcggaccgtcgacgctgagcgtgaccgccgggcggctggcgggctttcaccgg
gcgctgcgcgaagccggcgtgcccgagcacgccgcgcgcgtggccgaaggcgacttcacc
agccccggcggctaccgcgccgcgcgcgaactgctgaccaccggcgagacgcccaccgcc
atcttcgccagcaacgacctgatgggcatcggcgcgctgcgtgcggccgccgagctgggc
atcgcggtgccgaaggaactgtccatcatcggcttcgacgacatcgagctgagccgctat
gtctatccggcgctgtccacggtgggccagtcgatccggcaactgggcgagaccacggcc
tcaaccctgctcgagcacctgaccgatcacgccgcgcggcatcaccacgagatccccgac
gcgccgcgccgcatcgtgctgccgccgcgcctgtcgctgcgcgagtcgaccgccgagccc
gcacgccccgcgcgcgcggcctaa

DBGET integrated database retrieval system