KEGG   Ralstonia solanacearum GMI1000: RSc2581
Entry
RSc2581           CDS       T00071                                 
Symbol
trbE
Name
(GenBank) probable conjugal transfer protein trbe
  KO
K20530  type IV secretion system protein TrbE [EC:7.4.2.8]
Organism
rso  Ralstonia solanacearum GMI1000
Pathway
rso02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:rso00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    RSc2581 (trbE)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:rso02044]
    RSc2581 (trbE)
Enzymes [BR:rso01000]
 7. Translocases
  7.4  Catalysing the translocation of amino acids and peptides
   7.4.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.4.2.8  protein-secreting ATPase
     RSc2581 (trbE)
Secretion system [BR:rso02044]
 Type IV secretion system
  Trb secretion system protein
   RSc2581 (trbE)
SSDB
Motif
Pfam: CagE_TrbE_VirB P-loop_TraG DUF87 AAA_10 TraG-D_C HerA_C AAA_22 NACHT ABC_tran
Other DBs
NCBI-ProteinID: CAD16288
UniProt: Q8XW94
Position
complement(2787371..2789821)
AA seq 816 aa
MLNLAEYRQRPALLADWLPWAGLIAPGVVLNKDGSFQRTARFRGPDLDSATQGELIATTA
RLNNALRRLGSGWALFIEAERRPAADYPYSDFPEPLSWLVDEERRAAFEESGNHFESTYH
LTLAYLPPEESRARAAKLLYEHAPGDGVDWRGRLDAFVAETDRVFDLLDGVMPEIAWLDD
AATLTYLHATISTRRYRVGVPEVPFHLDALLADSALVGGLAPMLGDQHLRVVSVRGFPTS
TWPGLLDDLNRLGFAYRWSTRFLCLDKAEAEKELGRLRRQWFAKRKNVIALLRETIFQQE
SPLVDTDASNKAADADAALQELGSDQVAFGYLTATVTVLDADPAVADEKLRMVERVIQGR
GFVTIPETLNAVDAWLSSIPGNAYANVRQPIVSTLNLAHMMPLSAVWAGPERNKHLDGPP
VIVTRTDGATPFRLVTHIGDVGHMAVVGPTGMGKSAFLAVLAMQFRRYLHSRIFVFDMGR
SMRATILGLGGEHYDLGADGGIAFQPLAHIDAEGYRTWAAEWVEGRLLHEGVTVGPDEKA
GIWSALGSLAGAPVEQRTMTGLSVLLQSNALRQALAPYVLGGAHGKLLDADRDRLGSADV
QCFEMEELMASPAAVRSVLGYLFARFDERFDGSPTLLILDESWLFLDDPVFAARIRQWLK
TLRKRNVSVVFATQSLADIQNSSIAAAIIESCAVRIFLPNPQATEPQIRTIYEGFGLNSR
QIEIVATAQPKQDYYYQSRLGNRLFDLDLGPVVLAFAGASTPQDQRDIERVLTQAGAPGF
AGAWLRHRGLDWAADLLPSSPAAASVLATQPLEVSP
NT seq 2451 nt   +upstreamnt  +downstreamnt
atgctgaaccttgccgaataccgccagcggcccgccttgctggccgactggcttccttgg
gccgggctgatcgcaccgggtgtcgtcttgaacaaggacggcagtttccagcgcacagcc
cgtttccgtggtcccgatctcgatagcgccacgcaaggcgagttgatcgccaccacggcg
cggctgaacaacgcgctgcgccggctgggttcgggctgggcgctgttcatcgaggccgag
cgccgaccggccgcagactacccgtattccgacttccccgaaccactgtcctggctcgtg
gacgaggaacgccgcgccgccttcgaggaatcgggcaaccacttcgagagcacctatcac
ctgacgctggcctacctgccgccggaggaatcccgcgcccgtgcggccaagctgctgtac
gagcacgcgccgggcgatggcgtggactggcgcggtcggctcgatgccttcgtggcggaa
accgatcgcgtctttgacctgctcgatggcgtgatgccggaaatcgcctggctggacgat
gctgcgacgctgacctatctgcacgcgaccatctcgacgcggcgctaccgcgtgggcgtg
ccggaagtgccgtttcacctcgacgcgctgctggccgattccgccctggtcggcggcctc
gcgcccatgctgggcgaccagcacctgcgcgtggtgtcggtgcggggcttcccgacatcg
acctggccgggcctgctggacgacctcaaccgcctgggctttgcctatcgctggtcaacc
cggttcctctgcctcgacaaagcggaggcggaaaaggagctgggccgcctgcgccgccaa
tggtttgccaagcgcaagaatgtcatcgcgctgctgcgcgaaacgatctttcagcaggaa
tcgcccttggtggacacggatgccagcaacaaggcggccgacgccgacgctgcgttgcag
gagctgggcagcgatcaagtggccttcggctacctcaccgccacggtgacggtacttgat
gctgatccagccgtggccgacgaaaagctgcgcatggtggagcgcgtgattcagggccgc
ggctttgtaaccatccccgaaacgctcaatgccgtggatgcgtggctgtcgtccatccct
ggcaacgcctatgccaatgtgcgccagcccatcgtctcgacgttgaacctggcgcacatg
atgccgctgtcggcggtgtgggccggcccggagcgcaacaagcacttggacggcccgccg
gtgattgtcacgcgcactgacggcgcaacgccgtttcgcttggtcacgcacatcggcgac
gtgggccacatggccgtggtcggcccgaccggcatgggcaagtcggccttcctggccgtg
ctagcgatgcaattccggcgctatctgcactcgcgcatcttcgtcttcgacatgggccgc
tccatgcgcgccaccatcctgggcctgggaggcgagcactacgacctcggcgcggatggc
ggcattgcctttcagccactcgcgcacatcgacgcagagggctaccgcacctgggccgcc
gaatgggtggaaggccggctgctgcacgaaggcgtcaccgtcggcccggacgagaaggcc
ggcatctggtcggcgctcggcagtctggccggtgcgcccgtggagcagcgcacgatgacc
gggctttcggtgctgctgcaatcgaacgcgctgcgccaggcactcgcgccctatgtgctc
ggcggcgcacacggcaagctgctggatgcagaccgcgaccggctcggcagcgcggacgtt
cagtgcttcgagatggaggaactgatggccagccccgccgccgtgcggtcggtgctgggc
tacctgtttgcccgcttcgatgaacgattcgacggttcgcccacgctgctgatcctcgat
gaatcctggctgttcctggatgacccggtatttgccgcacgcatccgccagtggttgaag
acgctgcgcaagcgcaatgtcagtgtcgtcttcgctacgcaaagcctggcggatattcag
aactccagcatcgcggcggccatcatcgaaagctgcgcggttcggattttcttgcccaac
ccgcaggcgaccgaaccgcagattcgcacgatctacgagggcttcggcctcaacagccgg
caaatcgagatcgtcgccaccgcgcaacccaagcaggactactactaccaatcgcgcctc
ggcaatcgcctgttcgacctcgacctggggccggtcgtgctcgccttcgcaggcgcatcc
acaccgcaagaccaacgcgacatagagcgcgtgctgacgcaggccggcgctcccggcttc
gccggcgcgtggctgcgccatcgcggcctcgattgggccgccgacctgctgccgtcctcg
ccggcggcagcttctgtccttgctactcaaccgctggaggtttcgccatga

DBGET integrated database retrieval system