KEGG   Ruminococcus torques: RTO_10910
Entry
RTO_10910         CDS       T02606                                 

Definition
(GenBank) xanthine dehydrogenase, molybdenum binding subunit apoprotein
  KO
K00087  xanthine dehydrogenase molybdenum-binding subunit [EC:1.17.1.4]
Organism
rto  Ruminococcus torques
Pathway
rto00230  Purine metabolism
rto01100  Metabolic pathways
rto01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:rto00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    RTO_10910
Enzymes [BR:rto01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.1  With NAD+ or NADP+ as acceptor
    1.17.1.4  xanthine dehydrogenase
     RTO_10910
SSDB
Motif
Pfam: Ald_Xan_dh_C2 Ald_Xan_dh_C
Other DBs
NCBI-ProteinID: CBL25772
UniProt: D4M3G0
Position
1099719..1102028
AA seq 769 aa
MYVGKKVTRVDAYDKVIGRTKYTDDLCDKSAYIARILHSTIANGHVLSIDTSEAEKIPGV
VKVFTCFDLKEKHYFPTAGHPWSTDESHQDVADRLVLTDRVRFYGDDIAAVVAEDEVSAA
QALRAIKVEYEEYPFVLDVLDAMKEDAPQLHEDYPNNILKHTTIRKGNYEEAIKEPGLIK
VEGWYSTPTVQHCHIENFICYAEMEGDRIKVVSSTQIPHIVRRVVGQALGVEWGKIRVVK
PYIGGGFGNKQDVLYEPLCAWLSMQLHGHLIKLDVPREETFVSTRVRHAIKSHIISWVRP
DGTFAARKLEAFSDQGAYASHGHSICAKGVGAFPQLYPCDNVEADAYTIFTNKSVAGAMR
GYGIPQAMWAVECHTEDICAKLNMDPLEFRRKNLMPVGYKDAFSKNELYSDTFNQCLDKG
IEVTDYLRKYKEYQNQTGDIRRGIGMAVFWYNTAVWPISLETSSCRMVLNQDGSLQVQLG
ETEIGQGADTAYSQMTADILGVPLEAVHIVSCQDTDVTPFGTGAYASRQTYTAGFSIRQT
ALLLKERILKYAHELTRMPEYNLDIIDGQIVRITDNRVLMSLGDLSTEALYSLSHSEHLS
AESTAQIKSNAYSFGCTFAEVEVDIPMCKVKLLDIVNVHDAGTLINPALAEAQVHGGMSM
GIGFGLSENLLFDPKTGRALNNNLLDYKLSTFMDHPRLRAYFVENAEPTSAFGTKSLGEP
PTCSIAPAIRNAVYQATGVYVNDAPVNPHHLFRSMKEQHMFEEGGEANV
NT seq 2310 nt   +upstreamnt  +downstreamnt
atgtatgtaggaaaaaaggttactcgtgtagatgcctacgataaagtaattggacgtaca
aaatatacagatgatctctgtgataagagtgcctatattgcacgtattttacactctaca
attgccaacggacatgttctttctattgacacatctgaagctgagaagatacctggagtt
gtaaaagtatttacctgttttgatttaaaggagaagcattattttccaactgccggacat
ccatggtccacagatgaatcacatcaggatgttgccgatcgtcttgtacttacagaccgc
gtcagattttatggggatgatatcgctgcggttgtagcagaggatgaggtttccgctgca
caggcacttcgtgcgatcaaagtagaatatgaagaatatccatttgttctggatgttctg
gatgctatgaaagaggatgctcctcagcttcatgaggattatccgaacaatattctcaaa
cacacaacgatccgtaaaggtaactacgaagaagcaatcaaagaacctggactgatcaaa
gtagaaggctggtacagcacaccaaccgttcagcactgtcatattgaaaactttatctgc
tatgctgagatggaaggcgaccgcatcaaggttgtaagttctactcagattcctcatatc
gtacgtcgagttgtcggtcaggcactcggagttgaatggggtaagatccgtgtcgttaag
ccttacatcggcggtggtttcggaaataaacaggatgttttgtatgaaccactttgtgca
tggctgtccatgcagcttcacggacatcttattaaacttgatgtaccaagagaggagacc
tttgtttctactcgtgtacgtcatgcgatcaagagccacatcatttcatgggttcgcccg
gatggaacatttgctgcaagaaaactggaagcattttctgatcagggtgcttacgcatct
cacggtcacagtatctgtgccaaaggagttggcgcattcccgcagctttatccttgtgat
aacgtagaggctgatgcttatacaatattcacaaacaaatccgttgccggtgcgatgcgt
ggttacggaattccacaggcaatgtgggctgtagaatgtcatacagaagacatttgtgca
aaacttaacatggatccgcttgaattccgccgcaaaaacctgatgccagtcggatataag
gatgcattttctaaaaatgaattatacagcgacacattcaaccagtgcctcgacaaagga
atcgaagttactgattaccttcgtaaatacaaagaataccagaaccagacaggagatatc
cgcagaggtatcggtatggcagtcttctggtacaacacagctgtatggccaatctcactt
gagacatcttcctgccgtatggtattgaatcaggatggttctcttcaggttcagctcggt
gagacagagatcggacagggtgctgatactgcatattcacagatgactgcagatattctt
ggcgttccacttgaagctgtacacattgtttcctgtcaggatacagacgtcacaccattc
ggaacaggtgcttatgcatcccgtcagacttatacagccggattctcaattcgccagaca
gcactgcttctgaaagaacgcattttgaaatatgcgcatgaactgacaagaatgcctgaa
tataacctggatatcattgacggacagattgttcgcatcacagataaccgtgttctgatg
tctcttggagatctttcaacagaagcactttacagcctttcacacagtgagcatctgtca
gctgaaagtacagcacagattaagtccaatgcttactccttcggatgtacatttgcagaa
gttgaagttgacatcccgatgtgtaaggtaaaactgcttgatatcgtcaatgtacatgac
gccggaactcttatcaacccggcacttgctgaagctcaggtacacggtggtatgagtatg
ggaatcggattcggactttctgaaaacctgctctttgatccgaagaccggaagagcatta
aataataacttgctcgattacaagttatccacatttatggatcacccgagactacgcgct
tatttcgtagaaaatgcggagcctacaagtgcattcggaacaaaatctcttggtgagcca
ccgacatgttccattgcacctgcaatccgtaacgcagtttatcaggcaacaggtgtctat
gtaaatgatgcaccggtgaatccacaccatctgttccgcagtatgaaggaacaacatatg
tttgaggaaggaggagaagcaaatgtatga

DBGET integrated database retrieval system