KEGG   Staphylococcus aureus subsp. aureus USA300_FPR3757 (CA-MRSA): SAUSA300_1482
Entry
SAUSA300_1482     CDS       T00323                                 
Name
(GenBank) FtsK/SpoIIIE family protein
Organism
saa  Staphylococcus aureus subsp. aureus USA300_FPR3757 (CA-MRSA)
SSDB
Motif
Pfam: FtsK_SpoIIIE AAA_10 T2SSE ResIII HerA_C DUF87
Other DBs
NCBI-ProteinID: ABD21667
UniProt: A0A0H2XI98
Position
complement(1635968..1637326)
AA seq 452 aa
MAMNEIALFKGVRIQPYQKYIDFMFASVLAFIFLVYRIYILFIDYKSVNKKLDILTLFAY
FKPHLLYLLIGTAIIFVICKLIAQFLIRFKTKDLAEMIETQGFHNRTVIKKTTEYIPIDY
KQTEYDYYPTMFYKRGKKSFVIHIKKDGSRFQDNYLELETIIEPMFNSELVEKKHIGRYL
RYEFMPLKYKKRIVMNGEQESNTIFYDTKIAITHQITWDFVKAPHGLVTGITGGGKTYFL
FYVIRELFRRHSEVRLLDPKVSDLSFMKRVIGDDKVADTKGQILKQLREANNEMEERFRL
MNDSSDYKIGNDFRNFDMRPYFIIFDEVTAFTSTLDKKELQEMNDYLINIIMKGRQAGVF
MFLTAQRPDADVIKGNVRDQLGLRVSLGNLSNDGYRMTFGQTDKEFQTIHDSDIGRGYIS
ILGQYNEPILFDAPLMEQYDFVEDVKQILNKE
NT seq 1359 nt   +upstreamnt  +downstreamnt
atggcaatgaatgaaattgctttatttaaaggcgtacgtatacagccttatcagaagtat
attgattttatgtttgcaagtgtattagcatttatttttttggtatatcgtatatatatt
ttgtttattgattataaatcagttaataaaaaattggatatattgacgttgtttgcatat
tttaaaccgcatttattgtatttattaattggtacagcaattatatttgtgatatgtaag
cttattgctcagtttttaatacgttttaaaacaaaagatttggctgaaatgattgaaaca
caaggttttcataatcgtacagtaatcaagaaaacaactgagtatatccctattgattat
aaacaaactgaatatgattattatccaacaatgttttataagcgtggtaaaaaatctttt
gttattcatattaagaaagacggttcgaggtttcaagataattatttagagttagagacg
attattgaaccaatgtttaattctgaattagtagaaaaaaagcatattggtcgttatttg
agatatgaatttatgccacttaaatataaaaagcgtattgttatgaatggcgaacaagaa
tcaaatacaattttttatgatacaaaaattgctattacgcatcaaattacttgggatttt
gtgaaagcacctcatggattggttacaggtataaccggaggtggtaaaacatatttttta
ttttatgtgattcgtgagttattccgtagacattcagaagtacgtttattagacccaaaa
gtttcagatttgagctttatgaagcgcgttattggtgatgataaagttgcagatactaaa
ggtcaaatattaaaacaattgagagaagctaataatgaaatggaagagcgttttagatta
atgaatgatagttcggattataaaatcgggaatgatttccgtaattttgatatgcgcccc
tatttcattatttttgatgaggtaacagcttttacttcaactttagataaaaaagaatta
caagaaatgaatgattatttaattaatattattatgaaaggtcgtcaagctggtgtattt
atgtttttaacagcacaaagaccagatgcagatgtgattaaaggtaatgtgcgtgaccaa
ttagggttacgtgtgtctttaggtaatttgtcaaatgatggttatcgtatgacctttggt
caaactgataaagaatttcaaacgattcatgatagtgatatcggccgaggttatatttct
atacttggacaatataatgaaccaattttatttgatgcacctttaatggaacaatatgat
tttgtggaagatgtgaaacaaatattaaataaggagtga

DBGET integrated database retrieval system