KEGG   Staphylococcus aureus RF122: SAB0913c
Entry
SAB0913c          CDS       T00303                                 

Symbol
sspC
Name
(GenBank) cysteine protease
  KO
K23597  staphostatin B
Organism
sab  Staphylococcus aureus RF122
Brite
KEGG Orthology (KO) [BR:sab00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:sab01002]
    SAB0913c (sspC)
Peptidases and inhibitors [BR:sab01002]
 Peptidase inhibitors
  Family I57: staphostatin B family
   SAB0913c (sspC)
SSDB
Motif
Pfam: Staphostatin_B Staphostatin_A
Other DBs
NCBI-ProteinID: CAI80601
Structure
PDB: 
1NYC 1QWX 1PXV 1Y4H

Position
complement(989441..989770)
AA seq 109 aa
MYQLQFINLVYDTTKLTHLEQTNINLFIGNWSNHQLQKSICIRHGDDTSHNQYHILFIDT
AHQRIKFSSIDNEEIIYILDYDDTQHILMQTSSKQGIGTSRPIVYERLV
NT seq 330 nt   +upstreamnt  +downstreamnt
atgtatcaactacaatttataaatttagtttacgacacaaccaaactcacacatctagaa
caaacaaatatcaatttatttattggtaattggagtaatcatcaattacaaaaatcaatt
tgtatacgtcatggcgatgatacaagtcacaatcaatatcatattctttttatagatacg
gcacatcaacgtattaaattttcatctattgataatgaagaaatcatttatattcttgat
tatgatgatactcagcatatcctcatgcaaacgtcatccaaacaaggtattggcacttcg
cgaccaatcgtttatgagcgcttagtataa

DBGET integrated database retrieval system