KEGG   Staphylococcus aureus RF122: SAB2410c
Entry
SAB2410c          CDS       T00303                                 

Definition
(GenBank) conserved hypothetical protein
Organism
sab  Staphylococcus aureus RF122
Motif
Pfam: Thioredoxin Thioredoxin_3 Cytochrom_C1 DUF5947 Ldh_1_C Phosducin Toxin-deaminase HyaE
Other DBs
NCBI-ProteinID: CAI82098
Position
complement(2545132..2545476)
AA seq 114 aa
MVKQLNSVEAFREFIHQYPLAVVHVMRDQCSVCHAVLPQIEDLMQSYPNVPLAVINQSQV
EAIAGELNIFTVPVDLIFMNGKEMHRQGRFIDMQRFEHHLKQMNDSVNNDVDEH
NT seq 345 nt   +upstreamnt  +downstreamnt
atggttaagcaattaaatagtgtcgaagcattccgtgaatttattcatcaatatccgtta
gcagttgtacatgtcatgcgcgatcagtgtagcgtgtgtcatgccgttttaccacaaatt
gaagacttgatgcaatcatatcccaatgtgccattagctgtgattaatcaaagtcaggtg
gaagctattgctggagaattaaatattttcactgtacctgtggatttaatttttatgaat
ggaaaagaaatgcatcgtcaagggcgttttatcgatatgcaacgttttgaacatcatctt
aagcaaatgaatgatagtgtgaataacgatgtcgatgagcattaa

DBGET integrated database retrieval system