KEGG   Staphylococcus aureus subsp. aureus Newman: NWMN_2435
Entry
NWMN_2435         CDS       T00557                                 

Definition
(GenBank) conserved hypothetical protein
Organism
sae  Staphylococcus aureus subsp. aureus Newman
Motif
Pfam: Thioredoxin Thioredoxin_3 Cytochrom_C1 DUF5947 Ldh_1_C Phosducin Toxin-deaminase HyaE
Other DBs
NCBI-ProteinID: BAF68707
UniProt: A0A0H3KF56
Position
complement(2677141..2677485)
AA seq 114 aa
MVKQLNSVEAFREFIHQYPLAVVHVMRDQCSVCHAVLPQIEDLMQSYPNVPLAVINQSQV
EAIAGELNIFTVPVDLIFMNGKEMHRQGRFIDMQRFEHHLKQMNDSVNNDVDEH
NT seq 345 nt   +upstreamnt  +downstreamnt
atggttaagcaattaaatagtgtcgaagcattccgtgaatttattcatcaatatccgtta
gcagttgtacatgtcatgcgcgatcagtgtagcgtgtgtcatgccgttttaccacaaatt
gaagacttgatgcaatcatatcccaatgtgccattagctgtgattaatcaaagtcaggtg
gaagctattgctggagaattaaatattttcactgtacctgtggatttaatttttatgaat
ggaaaagaaatgcatcgtcaagggcgttttatcgatatgcaacgttttgaacatcatctt
aagcaaatgaatgatagtgtaaataacgatgtcgatgagcattaa

DBGET integrated database retrieval system