KEGG   Staphylococcus aureus subsp. aureus MW2 (CA-MRSA): MW0930
Entry
MW0930            CDS       T00086                                 

Symbol
sspC
Name
(GenBank) cysteine protease
  KO
K23597  staphostatin B
Organism
sam  Staphylococcus aureus subsp. aureus MW2 (CA-MRSA)
Brite
KEGG Orthology (KO) [BR:sam00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:sam01002]
    MW0930 (sspC)
Peptidases and inhibitors [BR:sam01002]
 Peptidase inhibitors
  Family I57: staphostatin B family
   MW0930 (sspC)
SSDB
Motif
Pfam: Staphostatin_B Staphostatin_A
Other DBs
NCBI-ProteinID: BAB94795
NITE: MW0930
UniProt: Q7A189
Structure
PDB: 
1NYC 1QWX 1PXV 1Y4H

Position
complement(1021760..1022089)
AA seq 109 aa
MYQLQFINLVYDTTKLTHLEQTNINLFIGNWSNHQLQKSICIRHGDDTSHNQYHILFIDT
AHQRIKFSSIDNEEIIYILDYDDTQHILMQTSSKQGIGTSRPIVYERLV
NT seq 330 nt   +upstreamnt  +downstreamnt
atgtatcaactacaatttataaatttagtttacgacacaaccaaactcacacatctagaa
caaaccaatatcaatttattcattggtaattggagtaatcatcaattacaaaaatcaatt
tgtatacgtcatggcgatgatacaagtcacaatcaatatcatattctttttatagatacg
gcacatcaacgcattaaattttcatctattgataatgaagaaatcatttatattcttgat
tatgatgatacacagcatatcctcatgcaaacgtcatccaaacaaggtattggcacttcg
cgcccaatcgtttatgagcgcttagtataa

DBGET integrated database retrieval system